DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dd and Ctdspl

DIOPT Version :9

Sequence 1:NP_608449.1 Gene:Dd / 33107 FlyBaseID:FBgn0029067 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_598471.3 Gene:Ctdspl / 69274 MGIID:1916524 Length:276 Species:Mus musculus


Alignment Length:206 Identity:83/206 - (40%)
Similarity:120/206 - (58%) Gaps:21/206 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ELFPL-SPVSRHRLSLVQ-----RKTLVLDLDETLIHSHHNAMPRNTVKPGTPHDFTVKVTIDRN 101
            ::.|: ||.:::.|..|.     :|.:|:||||||:||        :.||.:..||.|.|.||..
Mouse    83 QVIPVPSPPAKYLLPEVTVLDYGKKCVVIDLDETLVHS--------SFKPISNADFIVPVEIDGT 139

  Fly   102 PVRFFVHKRPHVDYFLDVVSQWYDLVVFTASMEIYGAAVADKLDNGRNILRRRYYRQHCTPDYGS 166
            ..:.:|.||||||.||..:.|.::.|:||||:..|...|||.||.. .:.|.|.:|:.|....|:
Mouse   140 IHQVYVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRW-GVFRARLFRESCVFHRGN 203

  Fly   167 YTKDLSAICSDLNRIFIIDNSPGAYRCFPNNAIPIKSWFSDPMDTALLSLLPMLDALRFTNDVRS 231
            |.||||.:..:|:::.|:||||.:|...|.||:|::|||.|..||.||.|:|..:.|...:||.|
Mouse   204 YVKDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLSREDDVYS 268

  Fly   232 VLSRNLHLHRL 242
            :      ||||
Mouse   269 M------LHRL 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DdNP_608449.1 HIF-SF_euk 60..228 CDD:274055 71/167 (43%)
CtdsplNP_598471.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
FCP1 <95..270 CDD:227517 76/189 (40%)
HIF-SF_euk 106..265 CDD:274055 71/167 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.