Sequence 1: | NP_608449.1 | Gene: | Dd / 33107 | FlyBaseID: | FBgn0029067 | Length: | 243 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_598471.3 | Gene: | Ctdspl / 69274 | MGIID: | 1916524 | Length: | 276 | Species: | Mus musculus |
Alignment Length: | 206 | Identity: | 83/206 - (40%) |
---|---|---|---|
Similarity: | 120/206 - (58%) | Gaps: | 21/206 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 43 ELFPL-SPVSRHRLSLVQ-----RKTLVLDLDETLIHSHHNAMPRNTVKPGTPHDFTVKVTIDRN 101
Fly 102 PVRFFVHKRPHVDYFLDVVSQWYDLVVFTASMEIYGAAVADKLDNGRNILRRRYYRQHCTPDYGS 166
Fly 167 YTKDLSAICSDLNRIFIIDNSPGAYRCFPNNAIPIKSWFSDPMDTALLSLLPMLDALRFTNDVRS 231
Fly 232 VLSRNLHLHRL 242 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dd | NP_608449.1 | HIF-SF_euk | 60..228 | CDD:274055 | 71/167 (43%) |
Ctdspl | NP_598471.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..31 | ||
FCP1 | <95..270 | CDD:227517 | 76/189 (40%) | ||
HIF-SF_euk | 106..265 | CDD:274055 | 71/167 (43%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5190 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1176152at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |