DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dd and ctdspl2a

DIOPT Version :9

Sequence 1:NP_608449.1 Gene:Dd / 33107 FlyBaseID:FBgn0029067 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001071012.1 Gene:ctdspl2a / 558181 ZFINID:ZDB-GENE-061013-647 Length:469 Species:Danio rerio


Alignment Length:219 Identity:75/219 - (34%)
Similarity:110/219 - (50%) Gaps:15/219 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FMFNRQVRAFIQYQPVKYELFPLSPVSRHRLSLVQRKTLVLDLDETLIHSHHNAMPRNTVKPGTP 89
            :.|.:.|....:.|..:....||...|....|      |||||||||:|...|.:....:     
Zfish   261 YFFIKHVPPLTEEQLTRKPALPLKTRSTPEFS------LVLDLDETLVHCSLNELEDAAL----- 314

  Fly    90 HDFTVKVTIDRNPVRFFVHKRPHVDYFLDVVSQWYDLVVFTASMEIYGAAVADKLDNGRNILRRR 154
               |..|.......:.:|..||....||:.:||.|::::||||.::|...:.:.||..:.::|.|
Zfish   315 ---TFPVLFQDVIYQVYVRLRPFFREFLERMSQIYEIILFTASKKVYADKLLNILDPKKQLVRHR 376

  Fly   155 YYRQHCTPDYGSYTKDLSAICSDLNRIFIIDNSPGAYRCFPNNAIPIKSWFSDPMDTALLSLLPM 219
            .:|:||....|:|.|||:.:..||::..||||||.|:....:|.|||:|||.|..|..||.|:|.
Zfish   377 LFREHCVCVQGNYIKDLNILGRDLSKTVIIDNSPQAFAYQLSNGIPIESWFVDKNDNELLKLVPF 441

  Fly   220 LDAL-RFTNDVRSVLSRNLHLHRL 242
            |:.| ....|||..:.....||.|
Zfish   442 LEKLVELNEDVRPYIRERFRLHDL 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DdNP_608449.1 HIF-SF_euk 60..228 CDD:274055 62/168 (37%)
ctdspl2aNP_001071012.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..136
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 181..209
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 231..250
HIF-SF_euk 290..445 CDD:274055 62/168 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.