DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dd and ctdsp1

DIOPT Version :9

Sequence 1:NP_608449.1 Gene:Dd / 33107 FlyBaseID:FBgn0029067 Length:243 Species:Drosophila melanogaster
Sequence 2:XP_021334687.1 Gene:ctdsp1 / 553744 ZFINID:ZDB-GENE-050522-523 Length:1222 Species:Danio rerio


Alignment Length:197 Identity:78/197 - (39%)
Similarity:112/197 - (56%) Gaps:15/197 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PVKYELFPLSPVSRHRLSLVQRKTLVLDLDETLIHSHHNAMPRNTVKPGTPHDFTVKVTIDRNPV 103
            |.|    ||.|..:.:  .|.:..:|:||||||:||        :.||....||.:.|.||....
Zfish  1036 PAK----PLLPQIKSK--DVGKICVVIDLDETLVHS--------SFKPVNNADFIIPVEIDGTVH 1086

  Fly   104 RFFVHKRPHVDYFLDVVSQWYDLVVFTASMEIYGAAVADKLDNGRNILRRRYYRQHCTPDYGSYT 168
            :.:|.||||||.||..:.:.::.|:||||:..|...|:|.||.. ...|.|.:|:.|....|:|.
Zfish  1087 QVYVLKRPHVDEFLKRMGELFECVLFTASLAKYADPVSDLLDKW-GAFRSRLFRESCVFHRGNYV 1150

  Fly   169 KDLSAICSDLNRIFIIDNSPGAYRCFPNNAIPIKSWFSDPMDTALLSLLPMLDALRFTNDVRSVL 233
            ||||.:..|||::.|:||||.:|...|:||:|:.|||.|..||.||.|:|..:.|...::|.:||
Zfish  1151 KDLSRLGRDLNKVIIVDNSPASYIFHPDNAVPVASWFDDMSDTELLDLIPFFERLSKVDNVYTVL 1215

  Fly   234 SR 235
            .:
Zfish  1216 KQ 1217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DdNP_608449.1 HIF-SF_euk 60..228 CDD:274055 69/167 (41%)
ctdsp1XP_021334687.1 HIF-SF_euk 1051..1209 CDD:274055 69/166 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.