DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dd and ctdspl2

DIOPT Version :9

Sequence 1:NP_608449.1 Gene:Dd / 33107 FlyBaseID:FBgn0029067 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001008438.1 Gene:ctdspl2 / 493278 XenbaseID:XB-GENE-950101 Length:466 Species:Xenopus tropicalis


Alignment Length:215 Identity:77/215 - (35%)
Similarity:112/215 - (52%) Gaps:22/215 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FIQYQPVKYELFPLSPVSRHR---LSLVQRKT----LVLDLDETLIHSHHNAMPRNTVKPGTPHD 91
            ||::.|      ||:....:|   |.|..|.|    |||||||||:|...|.:....:       
 Frog   260 FIKHVP------PLTEEQLNRKPALPLKTRSTPEFSLVLDLDETLVHCSLNELEDAAL------- 311

  Fly    92 FTVKVTIDRNPVRFFVHKRPHVDYFLDVVSQWYDLVVFTASMEIYGAAVADKLDNGRNILRRRYY 156
             |..|.......:.:|..||....||:.:||.|::::||||.::|...:.:.||..:.::|.|.:
 Frog   312 -TFPVLFQDVIYQVYVRLRPFFREFLERMSQIYEIILFTASKKVYADKLLNILDPKKRLVRHRLF 375

  Fly   157 RQHCTPDYGSYTKDLSAICSDLNRIFIIDNSPGAYRCFPNNAIPIKSWFSDPMDTALLSLLPMLD 221
            |:||....|:|.|||:.:..||::..||||||.|:....:|.|||:|||.|..|..||.|:|.|:
 Frog   376 REHCVCVQGNYIKDLNILGRDLSKTIIIDNSPQAFAYQLSNGIPIESWFMDKNDKELLKLVPFLE 440

  Fly   222 AL-RFTNDVRSVLSRNLHLH 240
            .| ....|||..:.....||
 Frog   441 NLVELNEDVRPHIRDRFRLH 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DdNP_608449.1 HIF-SF_euk 60..228 CDD:274055 64/172 (37%)
ctdspl2NP_001008438.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..136
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..238
HIF-SF_euk 287..442 CDD:274055 61/162 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.