DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dd and hzg

DIOPT Version :9

Sequence 1:NP_608449.1 Gene:Dd / 33107 FlyBaseID:FBgn0029067 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster


Alignment Length:193 Identity:82/193 - (42%)
Similarity:112/193 - (58%) Gaps:14/193 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PLSPVSRH-----RLSLVQRKTLVLDLDETLIHSHHNAMPRNTVKPGTPHDFTVKVTIDRNPVRF 105
            ||....|:     ||:.:.||.:|:||||||:||        :.||....||.|.|.||....:.
  Fly    93 PLPDQQRYLLPQVRLTDMHRKCMVIDLDETLVHS--------SFKPIPNADFIVPVEIDGTVHQV 149

  Fly   106 FVHKRPHVDYFLDVVSQWYDLVVFTASMEIYGAAVADKLDNGRNILRRRYYRQHCTPDYGSYTKD 170
            :|.||||||.||..:.:.|:.|:||||:..|...|||.||.. |:.|.|.:|:.|....|:|.||
  Fly   150 YVLKRPHVDEFLQKMGELYECVLFTASLAKYADPVADLLDKW-NVFRARLFRESCVYYRGNYIKD 213

  Fly   171 LSAICSDLNRIFIIDNSPGAYRCFPNNAIPIKSWFSDPMDTALLSLLPMLDALRFTNDVRSVL 233
            |:.:..||.:|.|:||||.:|...|:||:|:||||.|..|..|..|:|:.:.|...:.|.|||
  Fly   214 LNRLGRDLQKIVIVDNSPASYIFHPDNAVPVKSWFDDVTDCELRELIPLFEKLSKVDSVYSVL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DdNP_608449.1 HIF-SF_euk 60..228 CDD:274055 73/167 (44%)
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 73/166 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468340
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102985at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2492
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12210
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.