DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dd and ttm2

DIOPT Version :9

Sequence 1:NP_608449.1 Gene:Dd / 33107 FlyBaseID:FBgn0029067 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_612023.1 Gene:ttm2 / 38049 FlyBaseID:FBgn0035124 Length:409 Species:Drosophila melanogaster


Alignment Length:225 Identity:65/225 - (28%)
Similarity:99/225 - (44%) Gaps:43/225 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLSKVWTCICFMFNRQVRAFIQYQPVKYELF--PLSPVSRHRLSLVQRK-TLVLDLDETLIHSHH 76
            |:.:.|..:    ||..|.|  .:|.:.:|.  ||.|      ..||.. ||||::.:.|:|   
  Fly   173 LMWRTWKSV----NRFQRFF--KEPSRKKLLPDPLQP------PYVQPPYTLVLEIKDVLVH--- 222

  Fly    77 NAMPRNTVKPGTPHDFTVKVTIDRNPVRFFVHKRPHVDYFLDVVSQWYDLVVFTASMEIYGAAVA 141
               |..|.:.|.               ||  .|||.||.||...::::::||:||...:....:.
  Fly   223 ---PDWTYETGW---------------RF--KKRPGVDVFLKECAKYFEIVVYTAEQGVTVFPLV 267

  Fly   142 DKLD-NGRNILRRRYYRQHCTPDYGSYTKDLSAICSDLNRIFIIDNSPGAYRCFPNNAIPIKSWF 205
            |.|| ||  .:..|..|.....|.|.:.|:|..:..||.|:.::|....:.:..|:|:..|..|.
  Fly   268 DALDPNG--CIMYRLVRDSTHFDGGHHVKNLDNLNRDLKRVVVVDWDRNSTKFHPSNSFSIPRWS 330

  Fly   206 SDPMDTALLSLLPMLDALRFT--NDVRSVL 233
            .:..||.|..|...|..|..:  :|||.||
  Fly   331 GNDNDTTLFELTSFLSVLGTSEIDDVREVL 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DdNP_608449.1 HIF-SF_euk 60..228 CDD:274055 47/171 (27%)
ttm2NP_612023.1 CPDc 208..336 CDD:214729 41/152 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461637
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12210
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.