DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dd and Fcp1

DIOPT Version :9

Sequence 1:NP_608449.1 Gene:Dd / 33107 FlyBaseID:FBgn0029067 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001286846.1 Gene:Fcp1 / 37925 FlyBaseID:FBgn0035026 Length:880 Species:Drosophila melanogaster


Alignment Length:163 Identity:43/163 - (26%)
Similarity:71/163 - (43%) Gaps:29/163 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 RLSLVQRK-TLVLDLDETLIHSHHNAMPRNTVK---------PGTPHDFTVKVTIDRNPVRFFVH 108
            |..|..|| .|::|||:|:||:.::.:|.| :|         |.:|.              :...
  Fly   200 RRLLADRKLVLLVDLDQTVIHTTNDTVPDN-IKGIYHFQLYGPHSPW--------------YHTR 249

  Fly   109 KRPHVDYFLDVVSQWYDLVVFTASMEIYGAAVADKLD-NGRNILRRRYYRQHCTPDYGSYTKDLS 172
            .||....||:.:||.|:|.:.|.....|...:|..|| .|:....|...|..|. :..|.|.:|.
  Fly   250 LRPGTAEFLERMSQLYELHICTFGARNYAHMIAQLLDPEGKFFSHRILSRDECF-NATSKTDNLK 313

  Fly   173 AIC-SDLNRIFIIDNSPGAYRCFPNNAIPIKSW 204
            |:. :..:.:.|||:....:. ..:|.|.:|.:
  Fly   314 ALFPNGDSMVCIIDDREDVWN-MASNLIQVKPY 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DdNP_608449.1 HIF-SF_euk 60..228 CDD:274055 41/157 (26%)
Fcp1NP_001286846.1 Biotinyl_lipoyl_domains 59..142 CDD:299706
FCP1_euk 202..348 CDD:131304 42/161 (26%)
COG5275 481..>658 CDD:227600
BRCT 587..665 CDD:278934
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.