DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dd and Ublcp1

DIOPT Version :9

Sequence 1:NP_608449.1 Gene:Dd / 33107 FlyBaseID:FBgn0029067 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001014139.1 Gene:Ublcp1 / 360514 RGDID:1310386 Length:318 Species:Rattus norvegicus


Alignment Length:218 Identity:44/218 - (20%)
Similarity:74/218 - (33%) Gaps:80/218 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 RKTLVLDLDETLIHSHHNAMPRNTVKPGTPHDFTVKVTIDRNPVRFFVHKRPHVDYFLDVVSQWY 124
            :|.||||:|.||.  .|.:.....|:                      ..||::..||....:.|
  Rat   137 KKLLVLDVDYTLF--DHRSCAETGVE----------------------LMRPYLHEFLTSAYEDY 177

  Fly   125 DLVVFTAS--------MEIYGAA------VADKLDNGRNILRRRYYRQHCTPDYG---------- 165
            |:|:::|:        |:..|.:      :...||:...|...       ||..|          
  Rat   178 DIVIWSATNMKWIEAKMKELGVSTNANYKITFMLDSAAMITVH-------TPRRGLIDVKPLGVI 235

  Fly   166 ------SYTKDLSAICSDLNRIFIIDNSPGAYRCFPNNAIPI----KSWFSDPMDTALLSLLPML 220
                  .|:|..:.:..|:.|.|:::         |.|.:.|    |:..:...|..|:.|...|
  Rat   236 WGKFSEFYSKKNTIMFDDIGRNFLMN---------PQNGLKIRPFMKAHLNRDKDKELVKLTQYL 291

  Fly   221 DALRFTNDVRSVLSRNLHLHRLW 243
            ..:...:|   .|..|   |:.|
  Rat   292 KEIAKLDD---FLELN---HKYW 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DdNP_608449.1 HIF-SF_euk 60..228 CDD:274055 39/201 (19%)
Ublcp1NP_001014139.1 Ubl_UBLCP1 3..77 CDD:340511
HAD_IIID1 117..311 CDD:131299 44/218 (20%)
Phosphatase. /evidence=ECO:0000250 133..294 39/196 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.