DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dd and Ctdspl2

DIOPT Version :9

Sequence 1:NP_608449.1 Gene:Dd / 33107 FlyBaseID:FBgn0029067 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_997615.1 Gene:Ctdspl2 / 329506 MGIID:1196405 Length:465 Species:Mus musculus


Alignment Length:217 Identity:78/217 - (35%)
Similarity:113/217 - (52%) Gaps:22/217 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FIQYQPVKYELFPLSPVSRHR---LSLVQRKT----LVLDLDETLIHSHHNAMPRNTVKPGTPHD 91
            ||::.|      ||:....:|   |.|..|.|    |||||||||:|...|.:....:       
Mouse   259 FIKHVP------PLTEEQLNRKPALPLKTRSTPEFSLVLDLDETLVHCSLNELEDAAL------- 310

  Fly    92 FTVKVTIDRNPVRFFVHKRPHVDYFLDVVSQWYDLVVFTASMEIYGAAVADKLDNGRNILRRRYY 156
             |..|.......:.:|..||....||:.:||.|::::||||.::|...:.:.||..:.::|.|.:
Mouse   311 -TFPVLFQDVIYQVYVRLRPFFREFLERMSQMYEIILFTASKKVYADKLLNILDPKKQLVRHRLF 374

  Fly   157 RQHCTPDYGSYTKDLSAICSDLNRIFIIDNSPGAYRCFPNNAIPIKSWFSDPMDTALLSLLPMLD 221
            |:||....|:|.|||:.:..||::..||||||.|:....:|.|||:|||.|..|..||.|:|.|:
Mouse   375 REHCVCVQGNYIKDLNILGRDLSKTIIIDNSPQAFAYQLSNGIPIESWFMDKNDNELLKLIPFLE 439

  Fly   222 AL-RFTNDVRSVLSRNLHLHRL 242
            .| ....|||..:.....||.|
Mouse   440 KLVELNEDVRPHIRDRFRLHDL 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DdNP_608449.1 HIF-SF_euk 60..228 CDD:274055 64/172 (37%)
Ctdspl2NP_997615.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..133
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..239
HIF-SF_euk 286..447 CDD:274055 62/168 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.