DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dd and Ctdspl2

DIOPT Version :9

Sequence 1:NP_608449.1 Gene:Dd / 33107 FlyBaseID:FBgn0029067 Length:243 Species:Drosophila melanogaster
Sequence 2:XP_038960896.1 Gene:Ctdspl2 / 311368 RGDID:1309219 Length:478 Species:Rattus norvegicus


Alignment Length:217 Identity:78/217 - (35%)
Similarity:113/217 - (52%) Gaps:22/217 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FIQYQPVKYELFPLSPVSRHR---LSLVQRKT----LVLDLDETLIHSHHNAMPRNTVKPGTPHD 91
            ||::.|      ||:....:|   |.|..|.|    |||||||||:|...|.:....:       
  Rat   272 FIKHVP------PLTEEQLNRKPALPLKTRSTPEFSLVLDLDETLVHCSLNELEDAAL------- 323

  Fly    92 FTVKVTIDRNPVRFFVHKRPHVDYFLDVVSQWYDLVVFTASMEIYGAAVADKLDNGRNILRRRYY 156
             |..|.......:.:|..||....||:.:||.|::::||||.::|...:.:.||..:.::|.|.:
  Rat   324 -TFPVLFQDVIYQVYVRLRPFFREFLERMSQMYEIILFTASKKVYADKLLNILDPKKQLVRHRLF 387

  Fly   157 RQHCTPDYGSYTKDLSAICSDLNRIFIIDNSPGAYRCFPNNAIPIKSWFSDPMDTALLSLLPMLD 221
            |:||....|:|.|||:.:..||::..||||||.|:....:|.|||:|||.|..|..||.|:|.|:
  Rat   388 REHCVCVQGNYIKDLNILGRDLSKTIIIDNSPQAFAYQLSNGIPIESWFMDKNDNELLKLIPFLE 452

  Fly   222 AL-RFTNDVRSVLSRNLHLHRL 242
            .| ....|||..:.....||.|
  Rat   453 KLVELNEDVRPHIRDRFRLHDL 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DdNP_608449.1 HIF-SF_euk 60..228 CDD:274055 64/172 (37%)
Ctdspl2XP_038960896.1 HIF-SF_euk 299..460 CDD:274055 62/168 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.