DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dd and Ctdnep1

DIOPT Version :9

Sequence 1:NP_608449.1 Gene:Dd / 33107 FlyBaseID:FBgn0029067 Length:243 Species:Drosophila melanogaster
Sequence 2:XP_017452582.2 Gene:Ctdnep1 / 287447 RGDID:1310172 Length:285 Species:Rattus norvegicus


Alignment Length:250 Identity:149/250 - (59%)
Similarity:181/250 - (72%) Gaps:36/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RALLLLLSKVWTCICFMFNRQVRA--------------------------------FIQYQPVKY 42
            |..:...:|:|:...::..||:|.                                .||||.|:|
  Rat    11 RTFVAFAAKLWSFFIYLLRRQIRTETLAIMKGYLECRDCLDEPKHLWVLSLKLFSKVIQYQTVRY 75

  Fly    43 ELFPLSPVSRHRLSLVQRKTLVLDLDETLIHSHHNAMPRNTVKPGTPHDFTVKVTIDRNPVRFFV 107
            ::.||||:||:||:.|:||.||||||||||||||:.:.|.||:||||.||.:||.||::||||||
  Rat    76 DILPLSPLSRNRLAQVKRKILVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFV 140

  Fly   108 HKRPHVDYFLDVVSQWYDLVVFTASMEIYGAAVADKLDNGRNILRRRYYRQHCTPDYGSYTKDLS 172
            |||||||:||:||||||:||||||||||||:||||||||.|:||:|||||||||.:.|||.||||
  Rat   141 HKRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYIKDLS 205

  Fly   173 AICSDLNRIFIIDNSPGAYRCFP----NNAIPIKSWFSDPMDTALLSLLPMLDAL 223
            .:.|||:.|.|:||||||||..|    :||||||||||||.|||||:||||||||
  Rat   206 VVHSDLSSIVILDNSPGAYRSHPGMGKDNAIPIKSWFSDPSDTALLNLLPMLDAL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DdNP_608449.1 HIF-SF_euk 60..228 CDD:274055 127/167 (76%)
Ctdnep1XP_017452582.2 HIF-SF_euk 93..263 CDD:274055 127/167 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352664
Domainoid 1 1.000 278 1.000 Domainoid score I1644
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9100
Inparanoid 1 1.050 353 1.000 Inparanoid score I2186
OMA 1 1.010 - - QHG54256
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 1 1.000 - - FOG0002783
OrthoInspector 1 1.000 - - oto96256
orthoMCL 1 0.900 - - OOG6_105071
Panther 1 1.100 - - LDO PTHR12210
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1870
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.