DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dd and CTDNEP1

DIOPT Version :9

Sequence 1:NP_608449.1 Gene:Dd / 33107 FlyBaseID:FBgn0029067 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001137247.1 Gene:CTDNEP1 / 23399 HGNCID:19085 Length:244 Species:Homo sapiens


Alignment Length:234 Identity:168/234 - (71%)
Similarity:199/234 - (85%) Gaps:0/234 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RALLLLLSKVWTCICFMFNRQVRAFIQYQPVKYELFPLSPVSRHRLSLVQRKTLVLDLDETLIHS 74
            |..:...:|:|:...::..||:|..||||.|:|::.|||||||:||:.|:||.||||||||||||
Human    11 RTFVAFAAKLWSFFIYLLRRQIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETLIHS 75

  Fly    75 HHNAMPRNTVKPGTPHDFTVKVTIDRNPVRFFVHKRPHVDYFLDVVSQWYDLVVFTASMEIYGAA 139
            ||:.:.|.||:||||.||.:||.||::|||||||||||||:||:||||||:||||||||||||:|
Human    76 HHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSA 140

  Fly   140 VADKLDNGRNILRRRYYRQHCTPDYGSYTKDLSAICSDLNRIFIIDNSPGAYRCFPNNAIPIKSW 204
            |||||||.|:||:|||||||||.:.|||.||||.:.|||:.|.|:||||||||..|:||||||||
Human   141 VADKLDNSRSILKRRYYRQHCTLELGSYIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSW 205

  Fly   205 FSDPMDTALLSLLPMLDALRFTNDVRSVLSRNLHLHRLW 243
            ||||.|||||:|||||||||||.|||||||||||.||||
Human   206 FSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DdNP_608449.1 HIF-SF_euk 60..228 CDD:274055 131/167 (78%)
CTDNEP1NP_001137247.1 HIF-SF_euk 61..229 CDD:274055 131/167 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158657
Domainoid 1 1.000 278 1.000 Domainoid score I1725
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9100
Inparanoid 1 1.050 354 1.000 Inparanoid score I2253
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54256
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 1 1.000 - - FOG0002783
OrthoInspector 1 1.000 - - oto89125
orthoMCL 1 0.900 - - OOG6_105071
Panther 1 1.100 - - LDO PTHR12210
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2457
SonicParanoid 1 1.000 - - X1870
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.900

Return to query results.
Submit another query.