DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dd and Ctdsp1

DIOPT Version :9

Sequence 1:NP_608449.1 Gene:Dd / 33107 FlyBaseID:FBgn0029067 Length:243 Species:Drosophila melanogaster
Sequence 2:XP_036020359.1 Gene:Ctdsp1 / 227292 MGIID:2654470 Length:302 Species:Mus musculus


Alignment Length:273 Identity:86/273 - (31%)
Similarity:125/273 - (45%) Gaps:69/273 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLSKVWTCICF-------------MFNRQVRAFIQYQPVKYELFPLSPVSRHRLSLVQRKTLVLD 66
            :|..::.|:|.             :...:..|..::.||:|    |.|.::.:.|  .:..:|:|
Mouse    38 ILHSLFCCVCRDDGEPLPAHSGAPLLVEENGAIPKHTPVQY----LLPEAKAQDS--DKICVVID 96

  Fly    67 LDETLIHSHHNAMPRNTVKPGTPHDFTVKVTID-------------------------------R 100
            |||||:||        :.||....||.:.|.||                               .
Mouse    97 LDETLVHS--------SFKPVNNADFIIPVEIDGVVHQEWGMVGAASLDCPSSSTVPVPLLWITP 153

  Fly   101 NPV----------RFFVHKRPHVDYFLDVVSQWYDLVVFTASMEIYGAAVADKLDNGRNILRRRY 155
            .||          :.:|.||||||.||..:.:.::.|:||||:..|...|||.||.. ...|.|.
Mouse   154 KPVGQQLPHWLVPQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKW-GAFRARL 217

  Fly   156 YRQHCTPDYGSYTKDLSAICSDLNRIFIIDNSPGAYRCFPNNAIPIKSWFSDPMDTALLSLLPML 220
            :|:.|....|:|.||||.:..||.|:.|:||||.:|...|:||:|:.|||.:..||.|..|||..
Mouse   218 FRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFF 282

  Fly   221 DALRFTNDVRSVL 233
            :.|...:||.|||
Mouse   283 EQLSRVDDVYSVL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DdNP_608449.1 HIF-SF_euk 60..228 CDD:274055 71/208 (34%)
Ctdsp1XP_036020359.1 HIF-SF_euk 90..290 CDD:274055 71/208 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.