DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dd and scpl-1

DIOPT Version :9

Sequence 1:NP_608449.1 Gene:Dd / 33107 FlyBaseID:FBgn0029067 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_740912.2 Gene:scpl-1 / 181944 WormBaseID:WBGene00007054 Length:491 Species:Caenorhabditis elegans


Alignment Length:178 Identity:76/178 - (42%)
Similarity:104/178 - (58%) Gaps:15/178 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PLSPVSRHRLSLVQRKTLVLDLDETLIHSHHNAMPRNTVKPGTPHDFTVKVTIDRNPVRFFVHKR 110
            ||.|...:      :|.||:||||||:||        :.||....||.:.|.||....:.:|.||
 Worm   303 PLLPQDSN------KKCLVIDLDETLVHS--------SFKPVKNPDFVIPVEIDGVEHQVYVLKR 353

  Fly   111 PHVDYFLDVVSQWYDLVVFTASMEIYGAAVADKLDNGRNILRRRYYRQHCTPDYGSYTKDLSAIC 175
            |:||.||..|.:.::.::||||:..|...|||.||..| :.|.|.:|:.|....|:|.||||.:.
 Worm   354 PYVDEFLAKVGEHFECILFTASLAKYADPVADLLDKKR-VFRGRLFREACVFHKGNYVKDLSRLG 417

  Fly   176 SDLNRIFIIDNSPGAYRCFPNNAIPIKSWFSDPMDTALLSLLPMLDAL 223
            .:||:..||||||.:|...|.||:|:.:||.||.||.||.:||.|:.|
 Worm   418 RNLNQTLIIDNSPASYAFHPENAVPVTTWFDDPSDTELLDILPSLEHL 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DdNP_608449.1 HIF-SF_euk 60..228 CDD:274055 73/164 (45%)
scpl-1NP_740912.2 HIF-SF_euk 311..465 CDD:274055 72/162 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.