DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dd and fcp-1

DIOPT Version :10

Sequence 1:NP_608449.1 Gene:Dd / 33107 FlyBaseID:FBgn0029067 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_492423.2 Gene:fcp-1 / 172719 WormBaseID:WBGene00009479 Length:659 Species:Caenorhabditis elegans


Alignment Length:195 Identity:47/195 - (24%)
Similarity:76/195 - (38%) Gaps:59/195 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 SLVQRKTLVL--DLDETLIHSHHNAMPRNTVKPGTPHDFTVKVTIDRNPVRFFVHK-------RP 111
            :|:..:.|||  |||:|:||:....|   ||......|.|          ::.:|.       ||
 Worm   137 NLITNRKLVLLVDLDQTIIHTSDKPM---TVDTENHKDIT----------KYNLHSRVYTTKLRP 188

  Fly   112 HVDYFLDVVSQWYDLVVFTASMEIYGAAVADKLDNGRNILRRR-------YYRQHCTPDYGSYTK 169
            |...||:.:|..|::.:.|.....|...:|..||....:..:|       :..||       .|.
 Worm   189 HTTEFLNKMSNMYEMHIVTYGQRQYAHRIAQILDPDARLFEQRILSRDELFSAQH-------KTN 246

  Fly   170 DLSAI--CSDLNRIFIIDNSPGAYRCFPNNAIPIKSWFSDPMDTALLSLLPMLDALRFTNDVRSV 232
            :|.|:  |.| |.:.|||:....:            .:|:    ||:.:.|    .||..:|..:
 Worm   247 NLKALFPCGD-NLVVIIDDRSDVW------------MYSE----ALIQIKP----YRFFKEVGDI 290

  Fly   233  232
             Worm   291  290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DdNP_608449.1 HIF-SF_euk 60..228 CDD:274055 45/185 (24%)
fcp-1NP_492423.2 Haloacid Dehalogenase-like Hydrolases 138..284 CDD:473868 45/186 (24%)
BRCT_CTDP1 343..438 CDD:349361
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.