DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dd and scpl-3

DIOPT Version :9

Sequence 1:NP_608449.1 Gene:Dd / 33107 FlyBaseID:FBgn0029067 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001379798.1 Gene:scpl-3 / 172032 WormBaseID:WBGene00021629 Length:287 Species:Caenorhabditis elegans


Alignment Length:206 Identity:70/206 - (33%)
Similarity:110/206 - (53%) Gaps:14/206 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PVKYELFPLSPVSRHRLSLVQRKTLVLDLDETLIHSHHNAMPRNT-VKPGTPHDFTVKVTIDRNP 102
            |:..|:....|....:.......||||||||||:|.....:...| |.|....:.|.:|      
 Worm    43 PLTEEIMSRCPALPVKTRSTPEYTLVLDLDETLVHCSLTPLDNATMVFPVVFQNITYQV------ 101

  Fly   103 VRFFVHKRPHVDYFLDVVSQWYDLVVFTASMEIYGAAVADKLDNGRNILRRRYYRQHCTPDYGSY 167
               :|..|||:..||..:::.:::::||||.::|...:.|.||..:|.:|.|.:|:||...:|:|
 Worm   102 ---YVRLRPHLRTFLSRMAKTFEIIIFTASKKVYANKLCDILDPRKNHIRHRLFREHCVCVFGNY 163

  Fly   168 TKDLSAICSDLNRIFIIDNSPGAYRCFPNNAIPIKSWFSDPMDTALLSLLPMLDAL-RFTNDVRS 231
            .|||:.:..|.::..|:||:..::....:|.|||:|||.|..||.||.|...|:|: ....|||.
 Worm   164 VKDLTILGRDPSKTMILDNAVQSFAYQLDNGIPIESWFHDRNDTELLKLCSFLEAIPTLGRDVRE 228

  Fly   232 VLSRNLHLHRL 242
            :|.   |.:||
 Worm   229 ILR---HKYRL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DdNP_608449.1 HIF-SF_euk 60..228 CDD:274055 60/169 (36%)
scpl-3NP_001379798.1 HIF-SF_euk 66..220 CDD:274055 60/162 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54256
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.