DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dd and ctdspl

DIOPT Version :9

Sequence 1:NP_608449.1 Gene:Dd / 33107 FlyBaseID:FBgn0029067 Length:243 Species:Drosophila melanogaster
Sequence 2:XP_031759361.1 Gene:ctdspl / 100487887 XenbaseID:XB-GENE-1013061 Length:276 Species:Xenopus tropicalis


Alignment Length:197 Identity:79/197 - (40%)
Similarity:114/197 - (57%) Gaps:15/197 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PVKYELFPLSPVSRHRLSLVQRKTLVLDLDETLIHSHHNAMPRNTVKPGTPHDFTVKVTIDRNPV 103
            |.|| |.|...||.:     .:|.:|:||||||:||        :.||....||.|.|.||....
 Frog    91 PAKY-LLPELKVSDY-----GKKCVVIDLDETLVHS--------SFKPINNADFIVPVEIDGTIH 141

  Fly   104 RFFVHKRPHVDYFLDVVSQWYDLVVFTASMEIYGAAVADKLDNGRNILRRRYYRQHCTPDYGSYT 168
            :.:|.||||||.||..:.:.::.|:||||:..|...|||.||.. .:...|.:|:.|....|:|.
 Frog   142 QVYVLKRPHVDEFLQKMGELFECVLFTASLAKYADPVADLLDRW-GVFNARLFRESCVFHRGNYV 205

  Fly   169 KDLSAICSDLNRIFIIDNSPGAYRCFPNNAIPIKSWFSDPMDTALLSLLPMLDALRFTNDVRSVL 233
            ||||.:..:|:::.||||||.:|...|.||:|::|||.|..||.||.|:|..:.|...::|.::|
 Frog   206 KDLSRLGRELSKVIIIDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLSKEDNVYNML 270

  Fly   234 SR 235
            ::
 Frog   271 NK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DdNP_608449.1 HIF-SF_euk 60..228 CDD:274055 70/167 (42%)
ctdsplXP_031759361.1 HIF-SF_euk 106..264 CDD:274055 70/166 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.