DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dd and ctdsp1

DIOPT Version :9

Sequence 1:NP_608449.1 Gene:Dd / 33107 FlyBaseID:FBgn0029067 Length:243 Species:Drosophila melanogaster
Sequence 2:XP_017953012.1 Gene:ctdsp1 / 100380164 XenbaseID:XB-GENE-984307 Length:260 Species:Xenopus tropicalis


Alignment Length:179 Identity:77/179 - (43%)
Similarity:105/179 - (58%) Gaps:13/179 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LVLDLDETLIHSHHNAMPRNTVKPGTPHDFTVKVTIDRNPVRFFVHKRPHVDYFLDVVSQWYDLV 127
            :|:||||||:||        :.||....||.:.|.|:....:.:|.||||||.||..:.:.::.|
 Frog    92 VVIDLDETLVHS--------SFKPVNNADFIIPVEIEGTVHQVYVLKRPHVDEFLRRMGEMFECV 148

  Fly   128 VFTASMEIYGAAVADKLDNGRNILRRRYYRQHCTPDYGSYTKDLSAICSDLNRIFIIDNSPGAYR 192
            :||||:..|...|||.||.. ...|.|.:|:.|....|:|.||||.:..|||::.||||||.:|.
 Frog   149 LFTASLAKYADPVADLLDKW-GAFRSRLFRESCAFHRGNYVKDLSRLGRDLNKLIIIDNSPASYI 212

  Fly   193 CFPNNAIPIKSWFSDPMDTALLSLLPMLDALRFTNDVRSVLSRNLHLHR 241
            ..|:||:|:.|||.|..||.||.|||..:.:...:||.|||.:    ||
 Frog   213 FHPDNAVPVASWFDDMTDTELLDLLPFFERISRMDDVYSVLKQ----HR 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DdNP_608449.1 HIF-SF_euk 60..228 CDD:274055 70/164 (43%)
ctdsp1XP_017953012.1 HIF-SF_euk 89..248 CDD:274055 70/164 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.