DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt6 and NHO1

DIOPT Version :10

Sequence 1:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_178161.1 Gene:NHO1 / 844385 AraportID:AT1G80460 Length:522 Species:Arabidopsis thaliana


Alignment Length:78 Identity:19/78 - (24%)
Similarity:35/78 - (44%) Gaps:10/78 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 MAREHAPSIIFM--DEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRID 298
            :||....|:.|.  |.:||:.....|.||..:.:.     |.|.::||.....|   ::...:.|
plant   387 IARAVLESMCFQVKDVLDSMNKDAGEKGSLNNGKG-----EFLLRVDGGATANN---LLMQIQAD 443

  Fly   299 ILDPALLRPGRID 311
            ::...::||..|:
plant   444 LMGSPVVRPVDIE 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt6NP_608447.1 PRK03992 23..399 CDD:179699 19/78 (24%)
NHO1NP_178161.1 PLN02295 7..522 CDD:215166 19/78 (24%)

Return to query results.
Submit another query.