DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt6 and AT1G53780

DIOPT Version :9

Sequence 1:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001185217.1 Gene:AT1G53780 / 841815 AraportID:AT1G53780 Length:620 Species:Arabidopsis thaliana


Alignment Length:392 Identity:192/392 - (48%)
Similarity:259/392 - (66%) Gaps:12/392 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EIESAYHKGEGFRSYYIQKIEELQLVVAEKHQNLRRLQAQRN-------ELNAKVRMLREELQLL 65
            |...|:.:.|.: |..|:|:|:....:|||..||...::...       :|.:..:|::||..||
plant   217 EASEAHFEQEPY-SARIKKVEKEINELAEKICNLGIKESDTGLAPPNQWDLVSDKQMMQEEQPLL 280

  Fly    66 QEQGSYVGEVVKP-MDKKKVLVKVHPEGKFVVDLDKNIDINDVTPNCRVALRNESYTLHKILPNK 129
            .   :...:::.| .:..|.:|.:...||:||.|.......|:....||.:..:.|.:...||.|
plant   281 V---ATCTQIISPNTEDAKYVVDIKKIGKYVVGLGDKASPTDIEAGMRVGVDQKKYQIQIPLPPK 342

  Fly   130 VDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTG 194
            :||.|::|.||:.||:||..:||..:||::|:||:|||:.|||.|..|||..|||||.|||||:|
plant   343 IDPSVTMMTVEEKPDATYSDIGGCKEQIEKIREVVELPMLHPEKFVRLGIDPPKGVLCYGPPGSG 407

  Fly   195 KTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIE 259
            |||:|||||:.|...||||.|||||||:||||:|||||||.|||.....|:|.||||:||.:|.:
plant   408 KTLVARAVANRTGACFIRVVGSELVQKYIGEGARMVRELFQMARSKKACILFFDEIDAIGGARFD 472

  Fly   260 SGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEAR 324
            .|.|.|:||||||||:|.|||||:|..||||:|||||.||||||||||||:|||:||..|:.|.|
plant   473 DGVGSDNEVQRTMLEILYQLDGFDARGNIKVLMATNRPDILDPALLRPGRLDRKVEFCLPDLEGR 537

  Fly   325 LDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKV 389
            ..|.|||:|.|:..|.|....:|.|.|.::||:::.||.||||||:..||..||::||..||.||
plant   538 TQIFKIHTRTMSCERDIRFELLAGLCPNSTGADIRSVCIEAGMYAIGARRKSVTEKDFLDAVNKV 602

  Fly   390 MQ 391
            ::
plant   603 VK 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt6NP_608447.1 RPT1 17..403 CDD:224143 190/383 (50%)
SlyX <27..>69 CDD:294687 12/48 (25%)
AAA_16 152..>205 CDD:289934 35/52 (67%)
AAA 185..317 CDD:278434 94/131 (72%)
AT1G53780NP_001185217.1 cyclophilin <4..95 CDD:294131
RPT1 228..616 CDD:224143 189/381 (50%)
AAA 398..531 CDD:278434 95/132 (72%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D571919at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.