DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt6 and RPT1A

DIOPT Version :9

Sequence 1:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_175778.1 Gene:RPT1A / 841812 AraportID:AT1G53750 Length:426 Species:Arabidopsis thaliana


Alignment Length:385 Identity:192/385 - (49%)
Similarity:258/385 - (67%) Gaps:12/385 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GEGFRSYYIQKIEELQLVVAEKHQNLRRLQAQRN--------ELNAKVRMLREELQLLQEQGSYV 72
            |.|..|..|:|:|:....:|:|..:|..::....        :|.:..:|::||..|   |.:..
plant    30 GLGPYSAPIKKVEKEIKDLAKKINDLCGIKESDTGLAPPSQWDLVSDKQMMQEEQPL---QVARC 91

  Fly    73 GEVVKP-MDKKKVLVKVHPEGKFVVDLDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPLVSL 136
            .:::.| .:..|.::.|....||||.|...:...|:....||.:....|.:...||.|:||.|::
plant    92 TKIISPNTEDAKYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTM 156

  Fly   137 MMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARA 201
            |.||:.||.||..|||..:||::::||:|||:.|||.|..|||..|||||.||||||||||||||
plant   157 MTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPPKGVLCYGPPGTGKTLLARA 221

  Fly   202 VAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSGGDS 266
            ||:.|:..||||.|||||||::|||:|||||||.|||.....|:|.||:|:||.:|.:.|.|||:
plant   222 VANRTDACFIRVIGSELVQKYVGEGARMVRELFQMARSKKACIVFFDEVDAIGGARFDDGVGGDN 286

  Fly   267 EVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIH 331
            ||||||||::||||||:|..||||:|||||.|.||||||||||:|||:||..|:.|:|..|.|||
plant   287 EVQRTMLEIVNQLDGFDARGNIKVLMATNRPDTLDPALLRPGRLDRKVEFGLPDLESRTQIFKIH 351

  Fly   332 SRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQ 391
            :|.||..|.|....:|.|.|.::||:::.|||||||||:|.||..||::||..||.||::
plant   352 TRTMNCERDIRFELLARLCPNSTGADIRSVCTEAGMYAIRARRKTVTEKDFLDAVNKVIK 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt6NP_608447.1 RPT1 17..403 CDD:224143 191/384 (50%)
SlyX <27..>69 CDD:294687 9/49 (18%)
AAA_16 152..>205 CDD:289934 36/52 (69%)
AAA 185..317 CDD:278434 94/131 (72%)
RPT1ANP_175778.1 RPT1 26..423 CDD:224143 192/385 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D571919at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.