DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt6 and AT1G45000

DIOPT Version :9

Sequence 1:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_175120.1 Gene:AT1G45000 / 841065 AraportID:AT1G45000 Length:399 Species:Arabidopsis thaliana


Alignment Length:388 Identity:179/388 - (46%)
Similarity:254/388 - (65%) Gaps:15/388 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 YIQKI---EELQLVVAEKHQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGEVVKPMDKKKV 84
            |.:|:   :||:..|....:|||   |.:.|.|    ...::|:.||..|..:|||::|:|.:::
plant    18 YRKKLLHHKELESRVRTARENLR---AAKKEFN----KTEDDLKSLQSVGQIIGEVLRPLDNERL 75

  Fly    85 LVKVHPEGKFVVDLDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEM 149
            :||.....::||.....:|...:|...||.|...:.|:.:.||.:|||:|..|:.|...:.:|..
plant    76 IVKASSGPRYVVGCRSKVDKEKLTSGTRVVLDMTTLTIMRALPREVDPVVYNMLHEDPGNISYSA 140

  Fly   150 VGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVS 214
            ||||..||:|::|.||||:.:||||..:||..||||||||||||||||||||:|.:.:..|::|.
plant   141 VGGLGDQIRELRESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVV 205

  Fly   215 GSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQL 279
            .|.::.|:|||.:|::||:|..||||.|.||||||||:||..|...|:..|.|:|||::||||||
plant   206 SSAIIDKYIGESARLIREMFNYAREHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQL 270

  Fly   280 DGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLR 344
            |||:....:|:||||||.|:||||||||||:|||||.|.|||::|::|||||:..:.....|:..
plant   271 DGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHASGIAKHGEIDYE 335

  Fly   345 KIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAV-----AKVMQKDSEKNMSIKK 402
            .|.:|..|.:||:::.:||||||:|:|..|.:|..|||..||     ||.::..|..|....|
plant   336 AIVKLGEGFNGADLRNICTEAGMFAIRAERDYVIHEDFMKAVRKLSEAKKLESSSHYNADFGK 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt6NP_608447.1 RPT1 17..403 CDD:224143 179/388 (46%)
SlyX <27..>69 CDD:294687 12/44 (27%)
AAA_16 152..>205 CDD:289934 37/52 (71%)
AAA 185..317 CDD:278434 83/131 (63%)
AT1G45000NP_175120.1 RPT1 17..390 CDD:224143 176/378 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D571919at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.