DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt6 and KATNAL2

DIOPT Version :9

Sequence 1:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001340828.1 Gene:KATNAL2 / 83473 HGNCID:25387 Length:564 Species:Homo sapiens


Alignment Length:498 Identity:135/498 - (27%)
Similarity:215/498 - (43%) Gaps:135/498 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VTNRMEIESAYHKGEGFRSYYIQKIEELQLVVAEKHQNLRRLQAQRNELNAKVRMLREELQLLQE 67
            |.:.:::|:...:   :.|||..|.::...:|.:..........||:....: ||:.:..|.|.:
Human    88 VCDNIDLETILME---YESYYFVKFQKYPKIVKKSSDTAENNLPQRSRGKTR-RMMNDSCQNLPK 148

  Fly    68 QGSYVGEVVKPMDK--------KKVLVKVHPEGKFVVDLDKNIDINDVTPNCRVALRNESYTLH- 123
            ....     :|..|        .|.|.|.||.             .:|..|.|  |.:.::.|| 
Human   149 INQQ-----RPRSKTTAGKTGDTKSLNKEHPN-------------QEVVDNTR--LESANFGLHI 193

  Fly   124 ---------------------------------------KILPNKVDP----------------- 132
                                                   ....:..||                 
Human   194 SRIRKDSGEENAHPRRGQIIDFQGLLTDAIKGATSELALNTFDHNPDPSERLLKPLSAFIGMNSE 258

  Fly   133 ------LVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQP-KGVLLYGP 190
                  :||..:....|:..:..:.|||...:.:||.:..|:::|:||  .||..| ||:|||||
Human   259 MRELAAVVSRDIYLHNPNIKWNDIIGLDAAKQLVKEAVVYPIRYPQLF--TGILSPWKGLLLYGP 321

  Fly   191 PGTGKTLLARAVAHHTEC--TFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSI 253
            |||||||||:|||  |||  ||..:|.|.:|.|:.|:..::||.||.:||.||||.||:||::|:
Human   322 PGTGKTLLAKAVA--TECKTTFFNISASTIVSKWRGDSEKLVRVLFELARYHAPSTIFLDELESV 384

  Fly   254 GSSRIESGSGGDSEVQ-RTMLELLNQLDGFEATKNIKVIMATNRID-ILDPALLRPGRIDRKIEF 316
            .|.| .:.|||:.|.. |...|||.|:||...::::..::|.:.:. .||.|:||  |::::|..
Human   385 MSQR-GTASGGEHEGSLRMKTELLVQMDGLARSEDLVFVLAASNLPWELDCAMLR--RLEKRILV 446

  Fly   317 PPPNEEARLDILKIH-------SRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRE-- 372
            ..|:.|||..:: .|       ||.:.|...:....:::...|.||:::|.||.||.|..:|:  
Human   447 DLPSREARQAMI-YHWLPPVSKSRALELHTELEYSVLSQETEGYSGSDIKLVCREAAMRPVRKIF 510

  Fly   373 -------------RRVH---VTQEDFEMAVAKVMQKDSEKNMS 399
                         .|:.   ||..||...:...  |.|.||::
Human   511 DALENHQSESSDLPRIQLDIVTTADFLDVLTHT--KPSAKNLA 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt6NP_608447.1 RPT1 17..403 CDD:224143 133/484 (27%)
SlyX <27..>69 CDD:294687 7/41 (17%)
AAA_16 152..>205 CDD:289934 31/53 (58%)
AAA 185..317 CDD:278434 63/135 (47%)
KATNAL2NP_001340828.1 LisH 51..81 CDD:128913
SpoVK <264..559 CDD:223540 107/298 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.