DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt6 and RPT2a

DIOPT Version :9

Sequence 1:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_194633.1 Gene:RPT2a / 829025 AraportID:AT4G29040 Length:443 Species:Arabidopsis thaliana


Alignment Length:374 Identity:180/374 - (48%)
Similarity:259/374 - (69%) Gaps:8/374 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IQKIEELQLVVAEKHQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGEVVKPMDKKKVLV-- 86
            :::|::..|:..|...|..||:.|..    |....|.::..|:.....||.:.:.:|:...:|  
plant    68 LERIKDYLLMEEEFVANQERLKPQEE----KAEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSS 128

  Fly    87 KVHPEGKFVVDLDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVG 151
            .|.||  :.|.:...:|.:.:.|.|.:.:.|:..::..||.::|||:||:|.|||.|..:|..:|
plant   129 SVGPE--YYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMKVEKAPLESYADIG 191

  Fly   152 GLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGS 216
            ||:.||:||||.:|||:.||||::.:||..||||:|||.|||||||||:|||:.|..||:||.||
plant   192 GLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGS 256

  Fly   217 ELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDG 281
            ||:||::|:|.::|||||.:|.:.:|||:|:||||::|:.|.::.|||:.|:|||||||||||||
plant   257 ELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDG 321

  Fly   282 FEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKI 346
            |::..::|||:|||||:.||||||||||||||||||.|:.:.|..|.:||:.||.|:..:||.:.
plant   322 FDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTSKMTLSEDVNLEEF 386

  Fly   347 AELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSE 395
            .......|||::|.:|||||:.||||||:.||..||:.|..|||.|..|
plant   387 VMTKDEFSGADIKAICTEAGLLALRERRMKVTHPDFKKAKEKVMFKKKE 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt6NP_608447.1 RPT1 17..403 CDD:224143 180/374 (48%)
SlyX <27..>69 CDD:294687 10/41 (24%)
AAA_16 152..>205 CDD:289934 36/52 (69%)
AAA 185..317 CDD:278434 87/131 (66%)
RPT2aNP_194633.1 PTZ00361 7..443 CDD:185575 180/374 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D571919at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.