DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt6 and Gk

DIOPT Version :9

Sequence 1:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_008771496.1 Gene:Gk / 79223 RGDID:70893 Length:587 Species:Rattus norvegicus


Alignment Length:265 Identity:52/265 - (19%)
Similarity:90/265 - (33%) Gaps:84/265 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 DPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGK 195
            ||...|..|.:..:.|.|.:|.|:..|..||              |:|::..:...:.....||:
  Rat    56 DPKEILQSVYECIEKTCEKLGQLNIDISNIK--------------AIGVSNQRETTVVWDKLTGE 106

  Fly   196 TLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIES 260
            .|. .|||....      .||.:....:..||                     .:.:.|:|.:..
  Rat   107 PLY-NAVAAPVS------PGSSVPVAVVPSGS---------------------PVPAAGASSVWL 143

  Fly   261 GSGGDSEVQRTMLELLNQLDG----------------FEATK------NIKVI---MATNR--ID 298
                |...|.|:.:|..::.|                |.|.|      |:|.:   :..||  ..
  Rat   144 ----DLRTQSTVEKLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVKKVQEAVEENRALFG 204

  Fly   299 ILDPALL--RPGRIDRKIEFPPPNEEARLDILKIHS----RKMNLTRGINLRKIAELMPGA-SGA 356
            .:|..|:  ..|.|:..:........:|..:..|||    :::....||.:    |::|.. |.:
  Rat   205 TIDSWLIWSLTGGINGGVHCTDVTNASRTMLFNIHSLEWDKELCEFFGIPM----EILPNVRSSS 265

  Fly   357 EVKGV 361
            |:.|:
  Rat   266 EIYGL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt6NP_608447.1 RPT1 17..403 CDD:224143 52/265 (20%)
SlyX <27..>69 CDD:294687
AAA_16 152..>205 CDD:289934 12/52 (23%)
AAA 185..317 CDD:278434 28/160 (18%)
GkXP_008771496.1 glycerol_kin 11..547 CDD:273549 52/265 (20%)
FGGY_GK1-3_metazoa 11..547 CDD:212664 52/265 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.