DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt6 and gk5

DIOPT Version :9

Sequence 1:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001071271.3 Gene:gk5 / 777765 ZFINID:ZDB-GENE-061110-49 Length:529 Species:Danio rerio


Alignment Length:183 Identity:35/183 - (19%)
Similarity:64/183 - (34%) Gaps:36/183 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 NIDINDVTPNCRVALRNESYTLHKILPNKVDPLVSLM-----MVEKVPDSTYEMVGGLDKQIKEI 160
            ::|:...:..|.|      |.....:.......|||:     .||..||..:      |..:..:
Zfish    17 SVDVGTTSIRCHV------YDKSASIRGSCSAKVSLLYPQPGWVEIDPDELW------DGFVTVV 69

  Fly   161 KEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTL-------------LARAVAHHTECTFIR 212
            |..::.........::|||:..:...:.....|||..             |.|  :.:..||...
Zfish    70 KGAVQDSGLQMCQMESLGISTQRATFMTWDRNTGKPFHKFITWQDMRAAELVR--SWNGSCTMKT 132

  Fly   213 VSGSELVQKFIGEGSR-MVRELFVMAREHAPSIIFMDEIDSIGSSR--IESGS 262
            |.|...:..|:....| :...|.|...:|. |:..:..:::|...|  :|.|:
Zfish   133 VHGVMKMLHFLSRQKRFLAASLVVFTTQHV-SLRLVWALNNIPQLRQAVEDGT 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt6NP_608447.1 RPT1 17..403 CDD:224143 35/183 (19%)
SlyX <27..>69 CDD:294687
AAA_16 152..>205 CDD:289934 10/65 (15%)
AAA 185..317 CDD:278434 19/94 (20%)
gk5NP_001071271.3 GlpK 14..525 CDD:223628 35/183 (19%)
FGGY_GK5_metazoa 14..522 CDD:212665 35/183 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.