Sequence 1: | NP_608447.1 | Gene: | Rpt6 / 33105 | FlyBaseID: | FBgn0020369 | Length: | 405 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_083307.1 | Gene: | Shpk / 74637 | MGIID: | 1921887 | Length: | 476 | Species: | Mus musculus |
Alignment Length: | 207 | Identity: | 42/207 - (20%) |
---|---|---|---|
Similarity: | 72/207 - (34%) | Gaps: | 52/207 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 145 STYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVA---HHT 206
Fly 207 ECTFIRVSGSELVQKFIGEG---------SRMVREL------------FVMAREHAPSIIFMDEI 250
Fly 251 DSIGSSRIESGSGGDSEVQRTM----LELLNQLDGFEATKN---IKVI---MATNRIDILDPALL 305
Fly 306 RPGRIDRKIEFP 317 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rpt6 | NP_608447.1 | RPT1 | 17..403 | CDD:224143 | 42/207 (20%) |
SlyX | <27..>69 | CDD:294687 | |||
AAA_16 | 152..>205 | CDD:289934 | 10/55 (18%) | ||
AAA | 185..317 | CDD:278434 | 31/165 (19%) | ||
Shpk | NP_083307.1 | FGGY_SHK_like | 5..466 | CDD:212661 | 42/207 (20%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0554 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |