DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt6 and Shpk

DIOPT Version :9

Sequence 1:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_083307.1 Gene:Shpk / 74637 MGIID:1921887 Length:476 Species:Mus musculus


Alignment Length:207 Identity:42/207 - (20%)
Similarity:72/207 - (34%) Gaps:52/207 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 STYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVA---HHT 206
            |.|..:|.....:..|...::|....|..|..|....|...:.:. |...:|.|..|.:   .:.
Mouse   261 SVYSCMGQRTDAVLNISTSVQLAASMPVGFQPLQTPDPAAPVAFF-PYFDRTYLGVAASLNGGNV 324

  Fly   207 ECTFIRVSGSELVQKFIGEG---------SRMVREL------------FVMAREHAPSIIFMDEI 250
            ..||:.:    |||.....|         |||::..            .|:...|.|     |::
Mouse   325 LATFVHM----LVQWMADLGLEVEESTVYSRMIQAAAQQKDTHLTITPTVLGERHLP-----DQL 380

  Fly   251 DSIGSSRIESGSGGDSEVQRTM----LELLNQLDGFEATKN---IKVI---MATNRIDILDPALL 305
            .|:  :||.|.......|.|.:    ::.|:.:..|:..|.   .:|:   .|.:|.::|..   
Mouse   381 ASV--TRISSSDLSLGHVTRALCRGIVQNLHSMLPFQQLKEWGVARVVGSGSALSRNEVLKQ--- 440

  Fly   306 RPGRIDRKIEFP 317
               .:.|...||
Mouse   441 ---EVQRAFPFP 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt6NP_608447.1 RPT1 17..403 CDD:224143 42/207 (20%)
SlyX <27..>69 CDD:294687
AAA_16 152..>205 CDD:289934 10/55 (18%)
AAA 185..317 CDD:278434 31/165 (19%)
ShpkNP_083307.1 FGGY_SHK_like 5..466 CDD:212661 42/207 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.