DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt6 and Atad2

DIOPT Version :9

Sequence 1:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_081711.2 Gene:Atad2 / 70472 MGIID:1917722 Length:1364 Species:Mus musculus


Alignment Length:315 Identity:114/315 - (36%)
Similarity:172/315 - (54%) Gaps:47/315 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 RNESYTLHKILP-------------NKVDPLVSLMMVEKVPDST---YEMVGGLDKQIKEIKEVI 164
            ||.:..:::.||             :::....||..|:.:...|   ::.||||...|..:||::
Mouse   357 RNRNRAINRCLPLNFRKDEIRGIYKDRMKIGASLADVDPMQLDTSVRFDSVGGLSSHIAALKEMV 421

  Fly   165 ELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECT-------FIRVSGSELVQKF 222
            ..|:.:||:|:...|..|:|.|.||||||||||:|||:|:  ||:       |....|::.:.|:
Mouse   422 VFPLLYPEVFEKFKIQPPRGCLFYGPPGTGKTLVARALAN--ECSRGDKRVAFFMRKGADCLSKW 484

  Fly   223 IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDGFEATKN 287
            :||..|.:|.||..|.:..|:|||.||||.:...|........|.:..|:|.|   :||.::...
Mouse   485 VGESERQLRLLFDQAYQMRPAIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLAL---MDGLDSRGE 546

  Fly   288 IKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGIN--LRKIAELM 350
            |.||.||||:|.:||||.||||.||:..|..|::.||.:|||||:|..| .:.::  |.::||..
Mouse   547 IVVIGATNRLDSIDPALRRPGRFDREFLFSLPDKNARKEILKIHTRDWN-PKPVDMFLEELAEHC 610

  Fly   351 PGASGAEVKGVCTEAGMYALRER--RVHVTQE--------------DFEMAVAKV 389
            .|..||::|.:|.||.:.|||.|  :::.|.|              |||.|:.|:
Mouse   611 VGYCGADIKSICAEAALCALRRRYPQIYTTSEKLQLDLSSITISAKDFEAALQKI 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt6NP_608447.1 RPT1 17..403 CDD:224143 114/315 (36%)
SlyX <27..>69 CDD:294687
AAA_16 152..>205 CDD:289934 27/52 (52%)
AAA 185..317 CDD:278434 60/138 (43%)
Atad2NP_081711.2 AAA 438..579 CDD:214640 63/145 (43%)
AAA 443..577 CDD:278434 61/138 (44%)
Bromo_AAA 960..1070 CDD:99957
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.