DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt6 and PSMC1

DIOPT Version :9

Sequence 1:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_002793.2 Gene:PSMC1 / 5700 HGNCID:9547 Length:440 Species:Homo sapiens


Alignment Length:372 Identity:179/372 - (48%)
Similarity:253/372 - (68%) Gaps:4/372 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IQKIEELQLVVAEKHQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGEVVKPMDKKKVLVKV 88
            :::|::..|:..|..:|    |.|...|..|....|.::..|:.....||.:.:.:|....:|..
Human    65 LERIKDYLLMEEEFIRN----QEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVST 125

  Fly    89 HPEGKFVVDLDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGL 153
            ....:..|.:...:|.:.:.|.|.|.|.::.:.:..:|.:..||||::|.|||.|..||..:|||
Human   126 SVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGL 190

  Fly   154 DKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSEL 218
            |.||:||||.:|||:.|||.::.:||..||||:|||||||||||||:|||:.|..||:||.||||
Human   191 DNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSEL 255

  Fly   219 VQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDGFE 283
            :||::|:|.::|||||.:|.||||||:|:||||:||:.|.:|.|||:.|:||||||||||||||:
Human   256 IQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFD 320

  Fly   284 ATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAE 348
            :..::|||||||||:.|||||:||||||||||||.|:|:.:..|.:||:.:|.|...:.|..:..
Human   321 SRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIM 385

  Fly   349 LMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSE 395
            .....|||::|.:|||||:.||||||:.||.|||:.:...|:.|..|
Human   386 AKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQE 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt6NP_608447.1 RPT1 17..403 CDD:224143 179/372 (48%)
SlyX <27..>69 CDD:294687 10/41 (24%)
AAA_16 152..>205 CDD:289934 37/52 (71%)
AAA 185..317 CDD:278434 93/131 (71%)
PSMC1NP_002793.2 PTZ00361 1..440 CDD:185575 179/372 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..104 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.