DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt6 and FGGY

DIOPT Version :9

Sequence 1:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001106882.1 Gene:FGGY / 55277 HGNCID:25610 Length:575 Species:Homo sapiens


Alignment Length:287 Identity:52/287 - (18%)
Similarity:91/287 - (31%) Gaps:106/287 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 LVKVHPEGKFVVDLD--------------KNIDINDVTPNCRVALRNESYTLHKILPNKVDPLVS 135
            |:..|..|..|:..|              ..:.:...|.:|.:.:..:..    .:|....|..|
Human   258 LIDAHAGGLGVIGADVRGHGLICEGQPVTSRLAVICGTSSCHMGISKDPI----FVPGVWGPYFS 318

  Fly   136 LMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPEL------------------FDALGIAQP 182
            .|    || ..:...||.....|.|..:::.....|||                  .|.:..|||
Human   319 AM----VP-GFWLNEGGQSVTGKLIDHMVQGHAAFPELQVKATARCQSIYAYLNSHLDLIKKAQP 378

  Fly   183 KGVL---------------------LYGPPGTGKTLLARAVAHHTECTFI--RVSGSELVQ---- 220
            .|.|                     |.|...||...:....|.|:..:.:  :|:|.:|.|    
Human   379 VGFLTVDLHVWPDFHGNRSPLADLTLKGMRTTGYLYIPALAALHSPSSLLSPQVTGLKLSQDLDD 443

  Fly   221 ---------KFIGEGSRMVRELFVMAREHAPSIIFM-------------------------DEID 251
                     :.|..|:|.:.|. :.|..|:.|.:|:                         .|::
Human   444 LAILYLATVQAIALGTRFIIEA-MEAAGHSISTLFLCGGLSKNPLFVQMHADITGMPVVLSQEVE 507

  Fly   252 S--IGSSRIESGSGGD-SEVQRTMLEL 275
            |  :|::.:.:.:.|| :.||..|.::
Human   508 SVLVGAAVLGACASGDFASVQEAMAKM 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt6NP_608447.1 RPT1 17..403 CDD:224143 52/287 (18%)
SlyX <27..>69 CDD:294687
AAA_16 152..>205 CDD:289934 17/91 (19%)
AAA 185..317 CDD:278434 27/155 (17%)
FGGYNP_001106882.1 FGGY_YpCarbK_like 10..568 CDD:212663 52/287 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.