DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt6 and ATAD2B

DIOPT Version :9

Sequence 1:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_011531220.1 Gene:ATAD2B / 54454 HGNCID:29230 Length:1511 Species:Homo sapiens


Alignment Length:428 Identity:133/428 - (31%)
Similarity:220/428 - (51%) Gaps:54/428 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VTNRMEIESAYHKG-EGFRSYYIQKIEELQLVVAEKHQNLRRLQAQRNELNAKVRMLREELQLLQ 66
            :.|..|:.:   :| |..|:..:..:|::.:...|:..::...:|:..| |.:...||:.    :
Human   248 IQNHHEVST---EGEEEARTSKLLPLEKISIESQEEDGDIEVEEAEGEE-NDRPYNLRQR----K 304

  Fly    67 EQGSYVGEVVKPMDKKK---VLVKVH--PEGKFVVDLDKN-IDINDVTPNCRVAL-RNESYTL-- 122
            ....|....:.|..:||   .|..:|  |..:..:...|: |..:|.|.:..... |.:|.::  
Human   305 TVDRYQAPPIVPAHQKKRENTLFDIHRSPARRSHIRRKKHAIHSSDTTSSDEERFERRKSKSMAR 369

  Fly   123 --HKILPN--KVDPLVSLMMVEKVP-------------DST--YEMVGGLDKQIKEIKEVIELPV 168
              ::.||.  :.:.|.|.::.|:|.             |.:  ::.:|||...|..:||::..|:
Human   370 ARNRCLPMNFRAEDLASGILRERVKVGASLADVDPMNIDKSVRFDSIGGLSHHIHALKEMVVFPL 434

  Fly   169 KHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECT-------FIRVSGSELVQKFIGEG 226
            .:||:|:...|..|:|.|.||||||||||:|||:|:  ||:       |....|::.:.|::||.
Human   435 LYPEIFEKFKIQPPRGCLFYGPPGTGKTLVARALAN--ECSQGDKKVAFFMRKGADCLSKWVGES 497

  Fly   227 SRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDGFEATKNIKVI 291
            .|.:|.||..|....|||||.||||.:...|........|.:..|:|.|   :||.:....|.||
Human   498 ERQLRLLFDQAYLMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLAL---MDGLDNRGEIVVI 559

  Fly   292 MATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN--LTRGINLRKIAELMPGAS 354
            .||||:|.:||||.||||.||:..|..|:::||..||:||:|..|  |:... |.::||...|..
Human   560 GATNRLDSIDPALRRPGRFDREFLFNLPDQKARKHILQIHTRDWNPKLSDAF-LGELAEKCVGYC 623

  Fly   355 GAEVKGVCTEAGMYALRER--RVHVTQEDFEMAVAKVM 390
            ||::|.:||||.:.|||.|  :::.:....::.|:.::
Human   624 GADIKALCTEAALIALRRRYPQIYASSHKLQLDVSSIV 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt6NP_608447.1 RPT1 17..403 CDD:224143 130/413 (31%)
SlyX <27..>69 CDD:294687 7/41 (17%)
AAA_16 152..>205 CDD:289934 27/52 (52%)
AAA 185..317 CDD:278434 61/138 (44%)
ATAD2BXP_011531220.1 AAA 447..588 CDD:214640 64/145 (44%)
AAA 452..586 CDD:278434 62/138 (45%)
COG5076 866..>1100 CDD:227408
Bromo_AAA 974..1085 CDD:99957
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.