DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt6 and Kat60

DIOPT Version :9

Sequence 1:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001262276.1 Gene:Kat60 / 53566 FlyBaseID:FBgn0040208 Length:605 Species:Drosophila melanogaster


Alignment Length:295 Identity:113/295 - (38%)
Similarity:165/295 - (55%) Gaps:29/295 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 KILPNK------VDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQP 182
            |..||.      || ::...:::|.|...:..:..|....:.::|.:.||:..|:.|.  ||.:|
  Fly   297 KFQPNNHIEAELVD-ILERDILQKDPKVRWSDIADLHDAKRLLEEAVVLPMLMPDYFK--GIRRP 358

  Fly   183 -KGVLLYGPPGTGKTLLARAVAHHTEC--TFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSI 244
             ||||:.||||||||:||:|||  |||  ||..||.:.|..|:.||..:|||.||.|||.:|||.
  Fly   359 WKGVLMVGPPGTGKTMLAKAVA--TECGTTFFNVSSATLTSKYRGESEKMVRLLFEMARFYAPST 421

  Fly   245 IFMDEIDSIGSSRIESGSGGDSEV-QRTMLELLNQLDGF----EATKNIKVIMATNRIDILDPAL 304
            ||:|||||:.|.|   ||..:.|. :|...|||.|:||.    |..|.:.|:.|||....:|.||
  Fly   422 IFIDEIDSLCSRR---GSESEHEASRRVKSELLVQMDGVGGGEEQAKVVMVLAATNFPWDIDEAL 483

  Fly   305 LRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYA 369
            .|  |::::|..|.|::|.|..:|||:.|::.:...::|..:|..:.|.|||::..||.||.|.:
  Fly   484 RR--RLEKRIYIPLPSDEGREALLKINLREVKVDDSVDLTYVANELKGYSGADITNVCREASMMS 546

  Fly   370 LRERRVHVTQEDFEMAVAK-----VMQKDSEKNMS 399
            :|.:...:|.|.......:     |..||..:.||
  Fly   547 MRRKIAGLTPEQIRQLATEEVDLPVSNKDFNEAMS 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt6NP_608447.1 RPT1 17..403 CDD:224143 113/295 (38%)
SlyX <27..>69 CDD:294687
AAA_16 152..>205 CDD:289934 26/53 (49%)
AAA 185..317 CDD:278434 68/138 (49%)
Kat60NP_001262276.1 HCV_NS5a_C <163..243 CDD:289693
P-loop_NTPase 325..>381 CDD:304359 26/59 (44%)
AAA 358..496 CDD:214640 72/144 (50%)
AAA 362..495 CDD:278434 68/139 (49%)
Vps4_C <570..603 CDD:286426 5/12 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.