powered by:
Protein Alignment Rpt6 and Gk1
DIOPT Version :9
Sequence 1: | NP_608447.1 |
Gene: | Rpt6 / 33105 |
FlyBaseID: | FBgn0020369 |
Length: | 405 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_524655.1 |
Gene: | Gk1 / 43913 |
FlyBaseID: | FBgn0025592 |
Length: | 538 |
Species: | Drosophila melanogaster |
Alignment Length: | 51 |
Identity: | 13/51 - (25%) |
Similarity: | 22/51 - (43%) |
Gaps: | 12/51 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 322 EARLDILKIHSRKMNLTR------------GINLRKIAELMPGASGAEVKG 360
|..|:.:..::|.:|..| |:.||.:.:.:|..|.|..||
Fly 131 EELLETIPNNARNINYLRPLCGLPLSPYFSGVKLRWLRDNVPVVSQAMEKG 181
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0554 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.