DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt6 and Gk1

DIOPT Version :9

Sequence 1:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_524655.1 Gene:Gk1 / 43913 FlyBaseID:FBgn0025592 Length:538 Species:Drosophila melanogaster


Alignment Length:51 Identity:13/51 - (25%)
Similarity:22/51 - (43%) Gaps:12/51 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 EARLDILKIHSRKMNLTR------------GINLRKIAELMPGASGAEVKG 360
            |..|:.:..::|.:|..|            |:.||.:.:.:|..|.|..||
  Fly   131 EELLETIPNNARNINYLRPLCGLPLSPYFSGVKLRWLRDNVPVVSQAMEKG 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt6NP_608447.1 RPT1 17..403 CDD:224143 13/51 (25%)
SlyX <27..>69 CDD:294687
AAA_16 152..>205 CDD:289934
AAA 185..317 CDD:278434
Gk1NP_524655.1 glycerol_kin 18..522 CDD:273549 13/51 (25%)
FGGY_GK1-3_metazoa 18..522 CDD:212664 13/51 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.