DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt6 and Rpt3R

DIOPT Version :9

Sequence 1:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_649938.2 Gene:Rpt3R / 41190 FlyBaseID:FBgn0037742 Length:405 Species:Drosophila melanogaster


Alignment Length:396 Identity:161/396 - (40%)
Similarity:244/396 - (61%) Gaps:15/396 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EGFRSYYIQKIE--------ELQLVVAEKHQNLRRLQAQRNELNAKVRMLREELQLLQEQGS--- 70
            |....::.|.:|        :|.::..:....|..:|.|.:.:..:.|.|::|....||:..   
  Fly     6 EEIAQFHEQSLEKYDGLDPHDLYVLYKKLQMELELIQVQEDYIKEEQRNLKKEFIHAQEEVKRIK 70

  Fly    71 ----YVGEVVKPMDKKKVLVKVHPEGKFVVDLDKNIDINDVTPNCRVALRNESYTLHKILPNKVD 131
                .:|:.::.:|:...:|.......:.|.:...||...:.|:..|.|..:|..|..::|.:.|
  Fly    71 AVPLVIGQFLEAVDENNGIVASTTGSNYYVRVLSTIDREQLKPSSSVGLHKQSNCLVDLVPPEAD 135

  Fly   132 PLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKT 196
            ..:|::..::.||.:|..:||||.|.:||:|.:|||:.|.:|:..:||..|:||||:||||.|||
  Fly   136 STISMLSPDEKPDISYSDIGGLDIQKQEIREAVELPLTHAQLYKQIGIDPPRGVLLFGPPGCGKT 200

  Fly   197 LLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESG 261
            :||:||||||..:||||.|||.|||::|||.||||:||.:|::::|||||:||||:|.:.|.::.
  Fly   201 MLAKAVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDLFRLAKQNSPSIIFIDEIDAIATKRFDAQ 265

  Fly   262 SGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLD 326
            :|.|.||||.:||||||:|||:.|.||||||||||.|.||||||||||:|||||.|.|:...:..
  Fly   266 TGADREVQRILLELLNQMDGFDETTNIKVIMATNRADTLDPALLRPGRLDRKIELPLPDRRQKRL 330

  Fly   327 ILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQ 391
            :....:.|||:...::|..|.......|.|::..:|.||||:|:||.|..|..:|||......::
  Fly   331 VFTTITSKMNVGEDVDLEDIIARPDKISNADINAICQEAGMHAVRENRYVVNAKDFEKGYKTSVR 395

  Fly   392 KDSEKN 397
            ||..::
  Fly   396 KDEAQH 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt6NP_608447.1 RPT1 17..403 CDD:224143 161/396 (41%)
SlyX <27..>69 CDD:294687 10/49 (20%)
AAA_16 152..>205 CDD:289934 31/52 (60%)
AAA 185..317 CDD:278434 91/131 (69%)
Rpt3RNP_649938.2 PTZ00454 20..405 CDD:240423 158/382 (41%)
AAA 189..322 CDD:278434 91/132 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445444
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.