DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt6 and Gk2

DIOPT Version :9

Sequence 1:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001286904.1 Gene:Gk2 / 38221 FlyBaseID:FBgn0035266 Length:576 Species:Drosophila melanogaster


Alignment Length:252 Identity:52/252 - (20%)
Similarity:90/252 - (35%) Gaps:52/252 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 DPLVSLMMVEKVPDSTYEMVGGLDKQIKE-IKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTG 194
            |||              ||:..::|..:| ||::.|......::. .:||...:...:.....||
  Fly    76 DPL--------------EMMASINKCAEEAIKQLPEQGFSASDIV-TVGITNQRETTIVWDAVTG 125

  Fly   195 K--------------TLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSII 245
            |              |.:.:.||...:....|.|....:..:.  .:..:|.|    |::.|.: 
  Fly   126 KPLYNALLWKDIRTSTTVEQIVAKVQDPNHFRSSTGLPISTYF--SALKIRWL----RDNVPEV- 183

  Fly   246 FMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRI 310
                ..:|...|.::|:.....|.......|:..|...|::.:.:.:.|   ...||.||:...|
  Fly   184 ----RQAIRERRCKAGTVDSWIVWNLTNGALHITDVTNASRTLLMNLET---QAWDPVLLKTFGI 241

  Fly   311 DRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKG-VCTEAG 366
              :.|..|..........||.|.:..| ||:.|..|.    |...|.:.| :|.:.|
  Fly   242 --REEMLPTIHSCSEIFGKITSERSPL-RGMTLSGIM----GNQQASLLGQMCVKPG 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt6NP_608447.1 RPT1 17..403 CDD:224143 52/252 (21%)
SlyX <27..>69 CDD:294687
AAA_16 152..>205 CDD:289934 13/67 (19%)
AAA 185..317 CDD:278434 26/145 (18%)
Gk2NP_001286904.1 glycerol_kin 31..533 CDD:273549 52/252 (21%)
FGGY_GK1-3_metazoa 31..533 CDD:212664 52/252 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.