DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt6 and Gk5

DIOPT Version :9

Sequence 1:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_008764796.1 Gene:Gk5 / 367146 RGDID:1311223 Length:534 Species:Rattus norvegicus


Alignment Length:318 Identity:59/318 - (18%)
Similarity:111/318 - (34%) Gaps:71/318 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 KILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPEL-------------FD 175
            |::...|.  :...::..|.|::|.. |.:|      :|:..:|:....|             |:
  Rat   237 KLIATMVS--IPFSILPPVRDTSYNF-GSVD------EEIFGVPIPVVALVGDQQSAMFGECCFE 292

  Fly   176 ALGIAQPKGVLLYGPPGTGKT----------LLARAVAHHTECTFIRVSGSELVQKFIGE-GSRM 229
            ...:....|...:....||||          |:...:.|...|         |.:...|: |:.:
  Rat   293 TGDVKLTMGTGTFLDINTGKTPQHVNGGFYPLIGWKIGHELVC---------LAEGNAGDTGTAI 348

  Fly   230 V----RELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-----GDSEVQRTMLELLNQLDGFEAT 285
            |    .:||..|.|.....:.::  ||.|...:.|.||     .|.....:.:.|.:....:...
  Rat   349 VWAQKLDLFTDAAETEKMALSLE--DSEGVYFVPSFSGLQAPLNDPCACASFMGLKHSTSKYHLV 411

  Fly   286 KNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAEL- 349
            :.|...:|.....:.|       .:.|:|:.|..|..|...:.. ::..|.:|..:...||... 
  Rat   412 RAILESIAFRNKQLYD-------MLQREIQIPVTNIRADGGVCN-NAFVMQMTSDLINEKIDRPA 468

  Fly   350 ---MPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLW 404
               |.....|.:.|:.  .|.:|.:|....:.|.:.   |.|..:|..|..::::. |
  Rat   469 HFDMSCLGAASLAGLA--VGFWADKEELQKLRQSEM---VFKPQRKWQEYEVNMEN-W 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt6NP_608447.1 RPT1 17..403 CDD:224143 58/315 (18%)
SlyX <27..>69 CDD:294687
AAA_16 152..>205 CDD:289934 11/75 (15%)
AAA 185..317 CDD:278434 28/151 (19%)
Gk5XP_008764796.1 GlpK 23..530 CDD:223628 59/318 (19%)
FGGY_GK5_metazoa 25..527 CDD:212665 59/318 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.