DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt6 and Rpt4

DIOPT Version :9

Sequence 1:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_572308.3 Gene:Rpt4 / 31567 FlyBaseID:FBgn0028685 Length:397 Species:Drosophila melanogaster


Alignment Length:405 Identity:186/405 - (45%)
Similarity:259/405 - (63%) Gaps:27/405 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTVT-----NRMEIESAYHKGEGFRSYYIQKIEELQLVVAEKHQNLR-RLQAQRNELNAKVRML- 58
            ||||     :.:.:::.        |.|.:|:.|        |:.:. ||:.:|.|:....::. 
  Fly     1 MTVTATPMPDNLRVKAL--------SEYRKKLLE--------HKEIEGRLKEKREEIKDLTKLYD 49

  Fly    59 --REELQLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDLDKNIDINDVTPNCRVALRNESYT 121
              ..:|:.||..|..||||:|.:.:.|.:||.....::||...:.:|...:....||||...:.|
  Fly    50 KSENDLKALQSVGQIVGEVLKQLTEDKFIVKATNGPRYVVGCRRQLDKAKLKSGTRVALDMTTLT 114

  Fly   122 LHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVL 186
            :.:.||.:|||||..|..|...|.||..:|||..||:|::||||||:.:||||..:||..|||.|
  Fly   115 IMRYLPREVDPLVYNMSHEDPGDVTYSAIGGLTDQIRELREVIELPLLNPELFLRVGITPPKGCL 179

  Fly   187 LYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEID 251
            |||||||||||||||||...:..|::|..|.:|.|:|||.:|::||:|..||:|.|.||||||||
  Fly   180 LYGPPGTGKTLLARAVASQLDANFLKVVSSAIVDKYIGESARLIREMFNYARDHQPCIIFMDEID 244

  Fly   252 SIGSSRIESGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEF 316
            :||..|...|:..|.|:|||::|||||:|||::...:|:||||||.|.||||||||||:|||||.
  Fly   245 AIGGRRFSEGTSADREIQRTLMELLNQMDGFDSLGQVKMIMATNRPDTLDPALLRPGRLDRKIEI 309

  Fly   317 PPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQED 381
            |.|||:|||:|||||:.|:.....|:...|.:|....:||:::.||||||::|:|..|.:|.|||
  Fly   310 PLPNEQARLEILKIHALKIAKHGEIDYEAIVKLSDNFNGADLRNVCTEAGLFAIRAEREYVIQED 374

  Fly   382 FEMAVAKVMQKDSEK 396
            |..||.||  .|::|
  Fly   375 FMKAVRKV--SDNKK 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt6NP_608447.1 RPT1 17..403 CDD:224143 182/384 (47%)
SlyX <27..>69 CDD:294687 9/45 (20%)
AAA_16 152..>205 CDD:289934 38/52 (73%)
AAA 185..317 CDD:278434 82/131 (63%)
Rpt4NP_572308.3 RPT1 13..395 CDD:224143 182/393 (46%)
AAA 179..311 CDD:278434 82/131 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445445
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.