DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt6 and Fggy

DIOPT Version :9

Sequence 1:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_038965462.1 Gene:Fggy / 298250 RGDID:1359429 Length:558 Species:Rattus norvegicus


Alignment Length:266 Identity:57/266 - (21%)
Similarity:98/266 - (36%) Gaps:85/266 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 CRVALR-NESYTLHKILPNKVDPLVSLMMVEK----VP-----DSTYEMVGGLD----KQIKEIK 161
            |||... .:....|:|.....|...||::::|    :|     ||:..::..||    .|:..|.
  Rat    94 CRVTKEIVQGIDAHRIRGLGFDATCSLVVLDKEFHPLPVNREGDSSRNIIMWLDHRAVSQVHRIN 158

  Fly   162 E-----------VIELPVKHPELF----DALGIAQPKGVLLYGPP------GTGKTL--LARAVA 203
            |           |:.:.::.|:|.    :...|...|....:..|      .||.|.  |...|.
  Rat   159 ETKHSVLQYVGGVMSVEMQAPKLLWLKENLREICWDKAGHFFDLPDFLSWKATGVTARSLCSLVC 223

  Fly   204 HHT-------ECTFIRVSGSELVQKFIGE----------------GSRMVRELFVMARE-HAPSI 244
            ..|       :.:|.::.|   ::..||:                ||.::.|   .||| ..||.
  Rat   224 KWTYSAEKGWDDSFWKMIG---LEDLIGDNYNKIGNLVLPPGASLGSGLIPE---AARELGLPSG 282

  Fly   245 IFMDEIDSIGSSRIESGSGG----DSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDI---LDP 302
            |      ::.:|.|::.:||    .::|:...|    ..:|...|..:.||..|:...:   .||
  Rat   283 I------AVAASLIDAHAGGLGVIGADVRGHGL----TCEGQPVTSRLAVICGTSSCHMGISKDP 337

  Fly   303 ALLRPG 308
            ..: ||
  Rat   338 IFV-PG 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt6NP_608447.1 RPT1 17..403 CDD:224143 57/266 (21%)
SlyX <27..>69 CDD:294687
AAA_16 152..>205 CDD:289934 16/79 (20%)
AAA 185..317 CDD:278434 35/163 (21%)
FggyXP_038965462.1 FGGY_YpCarbK_like 41..536 CDD:212663 57/266 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.