DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt6 and Katna1

DIOPT Version :9

Sequence 1:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001004217.2 Gene:Katna1 / 292464 RGDID:1303062 Length:493 Species:Rattus norvegicus


Alignment Length:499 Identity:145/499 - (29%)
Similarity:231/499 - (46%) Gaps:113/499 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTVTNRMEIESAYHKGEGFRS---YY---IQKIEELQLVVAEKHQNLRRLQAQRNELNAKVRMLR 59
            :.:|..:::...|.....:.|   ||   :.:|.:....|.:.|.: ::.|....|:|.:.:.::
  Rat     6 LMITENVKLAREYALLGNYDSAMVYYQGVLDQINKYLYSVKDTHLH-QKWQQVWQEINVEAKHVK 69

  Fly    60 EELQLLQ--------------EQGSYVGEVVK---PMDKKKV----------------------- 84
            |.::.|:              |..|..|||..   |::::.:                       
  Rat    70 EIMKTLESFKLDSTSLKAAQHELPSSEGEVWSLPVPVERRPLPGPRKRQSTQHSDPKPHSNRPGA 134

  Fly    85 LVKVHPEGKFVVDLDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTY-- 147
            :|:.|......:..|:...:.......:...|.|.        ||:...|:.....|...:.|  
  Rat   135 VVRAHRPSAQSLHSDRGKAVRSREKKEQSKGREEK--------NKLPAAVTEPEANKFDSTGYDK 191

  Fly   148 EMVGGLDKQI-------------------KEIKEVIELPVKHPELFDALGIAQP-KGVLLYGPPG 192
            ::|..|::.|                   |.::|.:.||:..||.|.  ||.:| ||||:.||||
  Rat   192 DLVEALERDIISQNPNVRWYDIADLVEAKKLLQEAVVLPMWMPEFFK--GIRRPWKGVLMVGPPG 254

  Fly   193 TGKTLLARAVAHHTEC--TFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS 255
            |||||||:|||  |||  ||..||.|.|..|:.||..::||.||.|||.::|:.||:||||||.|
  Rat   255 TGKTLLAKAVA--TECKTTFFNVSSSTLTSKYRGESEKLVRLLFEMARFYSPATIFIDEIDSICS 317

  Fly   256 SRIESGSGGDSEV-QRTMLELLNQLDGF-------EATKNIKVIMATNRIDILDPALLRPGRIDR 312
            .|   |:..:.|. :|...|||.|:||.       :.:|.:.|:.|||....:|.||.|  |:::
  Rat   318 RR---GTSEEHEASRRVKAELLVQMDGVGGASENDDPSKMVMVLAATNFPWDIDEALRR--RLEK 377

  Fly   313 KIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRER---- 373
            :|..|.|:.:.|.::|:|..|::.|...:||..|||.|.|.|||::..||.:|.:.|:|.|    
  Rat   378 RIYIPLPSAKGREELLRISLRELELADDVNLASIAENMEGYSGADITNVCRDASLMAMRRRIEGL 442

  Fly   374 -----------RVHV--TQEDFEMAVAKVMQKDSEKNMSIKKLW 404
                       .:|:  |.||||||:.||.:..|..::...:.|
  Rat   443 TPEEIRNLSREEMHMPTTMEDFEMALKKVSKSVSAADIERYEKW 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt6NP_608447.1 RPT1 17..403 CDD:224143 142/480 (30%)
SlyX <27..>69 CDD:294687 9/55 (16%)
AAA_16 152..>205 CDD:289934 30/72 (42%)
AAA 185..317 CDD:278434 66/141 (47%)
Katna1NP_001004217.2 AAA 243..384 CDD:214640 70/147 (48%)
AAA 247..383 CDD:278434 66/142 (46%)
Vps4_C <458..491 CDD:286426 11/29 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.