powered by:
Protein Alignment Rpt6 and Shpk
DIOPT Version :9
Sequence 1: | NP_608447.1 |
Gene: | Rpt6 / 33105 |
FlyBaseID: | FBgn0020369 |
Length: | 405 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001028854.1 |
Gene: | Shpk / 287479 |
RGDID: | 1308004 |
Length: | 472 |
Species: | Rattus norvegicus |
Alignment Length: | 46 |
Identity: | 16/46 - (34%) |
Similarity: | 18/46 - (39%) |
Gaps: | 5/46 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 177 LGIAQPKGVLLYGPPG--TGKTLL---ARAVAHHTECTFIRVSGSE 217
||....|..||...|| :|..:| |||....||.......|.|
Rat 12 LGTTSVKAALLEAAPGHPSGFVVLASCARAAGAETESAAAGPQGRE 57
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0554 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.