DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt6 and Katna1

DIOPT Version :9

Sequence 1:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_035965.2 Gene:Katna1 / 23924 MGIID:1344353 Length:493 Species:Mus musculus


Alignment Length:314 Identity:120/314 - (38%)
Similarity:175/314 - (55%) Gaps:46/314 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 NKVD------PLVSLM---MVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQP- 182
            ||.|      .||..:   ::.:.|:..:..:..|.:..|.::|.:.||:..||.|.  ||.:| 
Mouse   182 NKFDGTGYDKDLVEALERDIISQNPNVRWYDIADLVEAKKLLQEAVVLPMWMPEFFK--GIRRPW 244

  Fly   183 KGVLLYGPPGTGKTLLARAVAHHTEC--TFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSII 245
            ||||:.|||||||||||:|||  |||  ||..||.|.|..|:.||..::||.||.|||.::|:.|
Mouse   245 KGVLMVGPPGTGKTLLAKAVA--TECKTTFFNVSSSTLTSKYRGESEKLVRLLFEMARFYSPATI 307

  Fly   246 FMDEIDSIGSSRIESGSGGDSEVQRTM-LELLNQLDGF-------EATKNIKVIMATNRIDILDP 302
            |:||||||.|.|   |:..:.|..|.| .|||.|:||.       :.:|.:.|:.|||....:|.
Mouse   308 FIDEIDSICSRR---GTSEEHEASRRMKAELLVQMDGVGGASENDDPSKMVMVLAATNFPWDIDE 369

  Fly   303 ALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGM 367
            ||.|  |::::|..|.|:.:.|.::|:|..|::.|...:||..|||.|.|.|||::..||.:|.:
Mouse   370 ALRR--RLEKRIYIPLPSAKGREELLRISLRELELADDVNLASIAENMEGYSGADITNVCRDASL 432

  Fly   368 YALRER---------------RVHV--TQEDFEMAVAKVMQKDSEKNMSIKKLW 404
            .|:|.|               .:|:  |.||||||:.|:.:..|..::...:.|
Mouse   433 MAMRRRIEGLTPEEIRNLSREAMHMPTTMEDFEMALKKISKSVSAADIERYEKW 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt6NP_608447.1 RPT1 17..403 CDD:224143 119/311 (38%)
SlyX <27..>69 CDD:294687
AAA_16 152..>205 CDD:289934 29/53 (55%)
AAA 185..317 CDD:278434 67/141 (48%)
Katna1NP_035965.2 AAA 243..384 CDD:214640 71/147 (48%)
AAA 247..383 CDD:278434 67/142 (47%)
Vps4_C <458..491 CDD:286426 10/29 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.