DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt6 and Psmc1

DIOPT Version :9

Sequence 1:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_476464.1 Gene:Psmc1 / 117263 RGDID:621097 Length:440 Species:Rattus norvegicus


Alignment Length:372 Identity:179/372 - (48%)
Similarity:253/372 - (68%) Gaps:4/372 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IQKIEELQLVVAEKHQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGEVVKPMDKKKVLVKV 88
            :::|::..|:..|..:|    |.|...|..|....|.::..|:.....||.:.:.:|....:|..
  Rat    65 LERIKDYLLMEEEFIRN----QEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVST 125

  Fly    89 HPEGKFVVDLDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGL 153
            ....:..|.:...:|.:.:.|.|.|.|.::.:.:..:|.:..||||::|.|||.|..||..:|||
  Rat   126 SVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGL 190

  Fly   154 DKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSEL 218
            |.||:||||.:|||:.|||.::.:||..||||:|||||||||||||:|||:.|..||:||.||||
  Rat   191 DNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSEL 255

  Fly   219 VQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDGFE 283
            :||::|:|.::|||||.:|.||||||:|:||||:||:.|.:|.|||:.|:||||||||||||||:
  Rat   256 IQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFD 320

  Fly   284 ATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAE 348
            :..::|||||||||:.|||||:||||||||||||.|:|:.:..|.:||:.:|.|...:.|..:..
  Rat   321 SRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIM 385

  Fly   349 LMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSE 395
            .....|||::|.:|||||:.||||||:.||.|||:.:...|:.|..|
  Rat   386 AKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQE 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt6NP_608447.1 RPT1 17..403 CDD:224143 179/372 (48%)
SlyX <27..>69 CDD:294687 10/41 (24%)
AAA_16 152..>205 CDD:289934 37/52 (71%)
AAA 185..317 CDD:278434 93/131 (71%)
Psmc1NP_476464.1 PTZ00361 1..440 CDD:185575 179/372 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..104 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.