DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt6 and atad2

DIOPT Version :9

Sequence 1:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_012820627.1 Gene:atad2 / 100496913 XenbaseID:XB-GENE-995542 Length:1366 Species:Xenopus tropicalis


Alignment Length:373 Identity:125/373 - (33%)
Similarity:190/373 - (50%) Gaps:78/373 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EKHQNLRRLQAQRNELNAK---VRMLREELQLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVD 97
            |:|.. |||...||:..::   :.:.|::|:.:|:            |:.|:       |..:.|
 Frog   366 EQHFE-RRLNRSRNKAISRCLPLNLQRDDLKGIQK------------DRMKI-------GASLAD 410

  Fly    98 LDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKE 162
            :|                           |.::|..|           .:..||||.|.|..:||
 Frog   411 VD---------------------------PMQIDATV-----------RFSSVGGLSKHISSLKE 437

  Fly   163 VIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECT-------FIRVSGSELVQ 220
            ::..|:.:||:|:...|..|:|.|.||||||||||:|||:|:  ||:       |....|::.:.
 Frog   438 MVVFPLLYPEIFEKFKIQPPRGCLFYGPPGTGKTLVARALAN--ECSIGDRRVAFFMRKGADCLS 500

  Fly   221 KFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDGFEAT 285
            |::||..|.:|.||..|.:..|||||.||||.:...|........|.:..|:|.|   :||.::.
 Frog   501 KWVGESERQLRLLFDQAYQMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLAL---MDGLDSR 562

  Fly   286 KNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN-LTRGINLRKIAEL 349
            ..|.||.||||:|.:||||.||||.||:..|..|::|||.||||||:::.| ....:.|.:::|.
 Frog   563 GEIVVIGATNRLDSIDPALRRPGRFDREFLFSLPDQEARKDILKIHTKEWNPKPSDLFLDELSEK 627

  Fly   350 MPGASGAEVKGVCTEAGMYALRER--RVHVTQEDFEMAV--AKVMQKD 393
            ..|..||::|.||.||.:.:||.|  :::.|.|..::.|  .|:..||
 Frog   628 CVGYCGADIKSVCAEAALCSLRRRYPQIYTTTEKLQLDVDSIKITAKD 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt6NP_608447.1 RPT1 17..403 CDD:224143 125/373 (34%)
SlyX <27..>69 CDD:294687 10/35 (29%)
AAA_16 152..>205 CDD:289934 28/52 (54%)
AAA 185..317 CDD:278434 61/138 (44%)
atad2XP_012820627.1 CDC48 <420..>692 CDD:273521 108/272 (40%)
ycf46 <709..929 CDD:177094
Bromo_AAA 981..1092 CDD:99957
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.