DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt6 and atad2b

DIOPT Version :9

Sequence 1:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_002936030.2 Gene:atad2b / 100496692 XenbaseID:XB-GENE-5956276 Length:1413 Species:Xenopus tropicalis


Alignment Length:272 Identity:106/272 - (38%)
Similarity:160/272 - (58%) Gaps:23/272 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 VDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTG 194
            |||    |.:::  ...::.||||.:.|..:||::..|:.:||:|:...|..|:|.|.|||||||
 Frog   358 VDP----MSLDR--SVRFDSVGGLSEHIYALKEMVVFPLLYPEIFEKFRIQPPRGCLFYGPPGTG 416

  Fly   195 KTLLARAVAHHTEC-------TFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDS 252
            |||:|||:|:  ||       :|....|::.:.|::||..|.:|.||..|....|||||.||||.
 Frog   417 KTLVARALAN--ECSQGDKKVSFFMRKGADCLSKWVGESERQLRLLFDQAYVMRPSIIFFDEIDG 479

  Fly   253 IGSSRIESGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFP 317
            :...|........|.:..|:|.|   :||.:....|.||.||||:|.:||||.||||.||:..|.
 Frog   480 LAPVRSSRQDQIHSSIVSTLLAL---MDGLDNRGEIVVIGATNRLDSIDPALRRPGRFDREFLFS 541

  Fly   318 PPNEEARLDILKIHSRKMN--LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRER--RVHVT 378
            .|:::||..||:||:|..|  |:... |.::||...|..||::|.:||||.:.|||.|  :::.:
 Frog   542 LPDQKARKHILQIHTRDWNPKLSDSF-LEELAEKCVGYCGADIKALCTEAALIALRRRYPQIYAS 605

  Fly   379 QEDFEMAVAKVM 390
            .:..::.::.|:
 Frog   606 SQKLQLDISSVV 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt6NP_608447.1 RPT1 17..403 CDD:224143 106/272 (39%)
SlyX <27..>69 CDD:294687
AAA_16 152..>205 CDD:289934 27/52 (52%)
AAA 185..317 CDD:278434 61/138 (44%)
atad2bXP_002936030.2 SpoVK <316..598 CDD:223540 104/251 (41%)
CDC48 <367..979 CDD:273521 102/257 (40%)
Bromo_AAA 928..1039 CDD:99957
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.