DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt6 and atad2b

DIOPT Version :9

Sequence 1:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001352895.1 Gene:atad2b / 100331225 ZFINID:ZDB-GENE-110411-210 Length:1402 Species:Danio rerio


Alignment Length:388 Identity:128/388 - (32%)
Similarity:200/388 - (51%) Gaps:53/388 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EKHQNLR-RLQAQRNE------LNAKVRMLREELQLLQEQGSYVGEVVKPMDKKKVLVKVH---- 89
            ::..||| |...||.|      :|.|           |.:||.......|..:..:.:|.|    
Zfish   275 DRPYNLRQRKTVQRYEAPPIEPVNRK-----------QSKGSLFDTHRSPARRSHIRIKKHAIHS 328

  Fly    90 -------PEGKFVVDLDKNIDINDVTPNC-RVALRNESYTLHKILPNKVDPLVSLMMVEKVPDST 146
                   .|.:|  :..|:..::.....| .:.||.|... ..:|.::|....||..|:.:...|
Zfish   329 SESTSSSDEERF--ERRKSKSMSRARNRCLPMNLRAEDLA-SGVLRDRVKVGASLADVDPMNLDT 390

  Fly   147 ---YEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTEC 208
               ::.||||...|:.:||::..|:.:|::|:...|..|:|.|.||||||||||:|||:|:  ||
Zfish   391 SVKFDSVGGLTHHIQSLKEMVVFPLLYPQVFEKFKIQPPRGCLFYGPPGTGKTLVARALAN--EC 453

  Fly   209 -------TFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSGGDS 266
                   :|....|::.:.|::||..|.:|.||..|....|||||.||||.:...|........|
Zfish   454 SQGDRKVSFFMRKGADCLSKWVGESERQLRLLFDQAYLMRPSIIFFDEIDGLAPVRSSRQDQIHS 518

  Fly   267 EVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIH 331
            .:..|:|.|   :||.::...|.||.||||:|.:||||.||||.||:..|..|:::||..||:||
Zfish   519 SIVSTLLAL---MDGLDSRGEIVVIGATNRLDSIDPALRRPGRFDREFLFNLPDKKARKHILEIH 580

  Fly   332 SRKMN--LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRER--RVHVTQEDFEMAVAKVM 390
            :|..:  |.... :.::||...|..||::|.:||||.:.|||.|  :::.:.:.:::.||.::
Zfish   581 TRDWSPKLAEPF-IDELAERCVGYCGADIKALCTEAALAALRRRYPQIYGSSQRYQLDVASIV 642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt6NP_608447.1 RPT1 17..403 CDD:224143 128/388 (33%)
SlyX <27..>69 CDD:294687 10/39 (26%)
AAA_16 152..>205 CDD:289934 26/52 (50%)
AAA 185..317 CDD:278434 61/138 (44%)
atad2bNP_001352895.1 SpoVK <341..657 CDD:223540 111/309 (36%)
P-loop_NTPase 767..879 CDD:328724
Bromo_AAA 957..1068 CDD:99957
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.