DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1801 and rbsA

DIOPT Version :9

Sequence 1:NP_728408.3 Gene:CG1801 / 33104 FlyBaseID:FBgn0031171 Length:1655 Species:Drosophila melanogaster
Sequence 2:NP_418205.1 Gene:rbsA / 948264 ECOCYCID:EG10814 Length:501 Species:Escherichia coli


Alignment Length:297 Identity:65/297 - (21%)
Similarity:118/297 - (39%) Gaps:80/297 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1260 REKKFHTSRDL--------------RKMRTATYPFDDGDVADVKQKIAEADNTKAKQSVFLVDQV 1310
            |:.:|...|::              ||:.. .||..|....|::.|:   ||             
E. coli   215 RDGQFIAEREVASLTEDSLIEMMVGRKLED-QYPHLDKAPGDIRLKV---DN------------- 262

  Fly  1311 EARVPAAGKRIHTVSFALNKYMSMGIFGPRNSGKSHLMRQLVG---------------------Q 1354
                 ..|..::.|||.|.|...:|:.|...:|::.||:.|.|                     |
E. coli   263 -----LCGPGVNDVSFTLRKGEILGVSGLMGAGRTELMKVLYGALPRTSGYVTLDGHEVVTRSPQ 322

  Fly  1355 RGFAFGEIYVRGLDFKYDLESIHTYMGYSPQHRGLLNELTPREHIRLLCMI------RGVPEAKI 1413
            .|.|.|.:|: ..|.|.|               ||:..::.:|::.|..:.      ..:..|..
E. coli   323 DGLANGIVYI-SEDRKRD---------------GLVLGMSVKENMSLTALRYFSRAGGSLKHADE 371

  Fly  1414 GEKMHDLCLMLNM-TGWMHRKCSLLTAEKRHKLKIALALVAYNKILVLDEPTCGMPATTRREIWN 1477
            .:.:.|...:.|: |..|.:...||:...:.|:.||..|:...|:|:|||||.|:....::||:.
E. coli   372 QQAVSDFIRLFNVKTPSMEQAIGLLSGGNQQKVAIARGLMTRPKVLILDEPTRGVDVGAKKEIYQ 436

  Fly  1478 ILRYIRYCGKTIIFATNDELECKILADFIILFQDSEM 1514
            ::...:..|.:||..:::..|...::|.||:..:..:
E. coli   437 LINQFKADGLSIILVSSEMPEVLGMSDRIIVMHEGHL 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1801NP_728408.3 ABC2_membrane_3 <246..379 CDD:289468
ABC2_membrane_4 <293..448 CDD:289500
EcfA2 499..717 CDD:224047
P-loop_NTPase 500..721 CDD:304359
ABC2_membrane_3 <972..1254 CDD:289468
EcfA2 1307..1521 CDD:224047 53/236 (22%)
P-loop_NTPase 1324..1524 CDD:304359 52/219 (24%)
rbsANP_418205.1 PRK10762 1..501 CDD:236755 65/297 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X215
SwiftOrtho 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.