DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1801 and afuC

DIOPT Version :9

Sequence 1:NP_728408.3 Gene:CG1801 / 33104 FlyBaseID:FBgn0031171 Length:1655 Species:Drosophila melanogaster
Sequence 2:NP_414796.2 Gene:afuC / 947676 ECOCYCID:EG12340 Length:348 Species:Escherichia coli


Alignment Length:379 Identity:89/379 - (23%)
Similarity:154/379 - (40%) Gaps:96/379 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   500 MRLRHVSTSHRDSERKILKNISMRIYRGEVFVILGHIGSGKLTLLRILAGLKFPLRGNVYIMGNP 564
            :.||:|  :.|.....::.||::.|.:|::..:||..|.||.|:||::|||:.|..|.::|.|..
E. coli     7 VELRNV--TKRFGSNTVIDNINLTIPQGQMVTLLGPSGCGKTTILRLVAGLEKPSEGQIFIDGED 69

  Fly   565 FEPNGEARRLVDFRFDEHGLNKHLTVEQTIDYHVRLKLSPSESDRYEIERR--KWLAILD-QHVE 626
            .......:|.:...|..:.|..|:::.:.:.|.:::...|    |.|::.|  :.||::| :..|
E. coli    70 VTHRSIQQRDICMVFQSYALFPHMSLGENVGYGLKMLGVP----RAELKARVKEALAMVDLEGFE 130

  Fly   627 SRGVRIGKLSSGSMKLVALCCCLAGDTPIIILEEPTTQLTG----------REAQIFWSIVHAEK 681
            .|.|  .::|.|..:.|||...|.....:::.:||.:.|..          ||.|..:.|..   
E. coli   131 DRFV--DQISGGQQQRVALARALILKPKVLLFDEPLSNLDANLRRSMRDKIRELQKQFDITS--- 190

  Fly   682 ENRAFIIATYNVGEAEHVADRIGILSMGVLEASGTPFFLRSKFSSSVDLVIIKKPHVPDQPITDY 746
                 :..|::..||..|:|.:.:::.|.:...|:|          .||.        .||.:.:
E. coli   191 -----LYVTHDQSEAFAVSDTVLVMNKGHIMQIGSP----------QDLY--------RQPASRF 232

  Fly   747 INQFM--QNIEP---ENEIGDSLTYRLPVIYRPRLQKLLIHLEIDRKMLGIENVRVVGAELSD-- 804
            :..||  .|:.|   .:...|...|.||   ||        |....:..|:..||.....|||  
E. coli   233 MASFMGDANLFPATFSDGYVDIYGYHLP---RP--------LHFGTQGEGMVGVRPEAITLSDRG 286

  Fly   805 -----------IYM----------------TLVTSFRLQQQMIPDVTQTFKYQV 831
                       .||                ..|.:.|||    |||.:.:..::
E. coli   287 EESQRCVIRHVAYMGPQYEVTVEWHGQEILLQVNATRLQ----PDVGEQYYLEI 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1801NP_728408.3 ABC2_membrane_3 <246..379 CDD:289468
ABC2_membrane_4 <293..448 CDD:289500
EcfA2 499..717 CDD:224047 58/229 (25%)
P-loop_NTPase 500..721 CDD:304359 59/233 (25%)
ABC2_membrane_3 <972..1254 CDD:289468
EcfA2 1307..1521 CDD:224047
P-loop_NTPase 1324..1524 CDD:304359
afuCNP_414796.2 fbpC 1..348 CDD:183133 89/379 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm14986
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.