DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1801 and proV

DIOPT Version :9

Sequence 1:NP_728408.3 Gene:CG1801 / 33104 FlyBaseID:FBgn0031171 Length:1655 Species:Drosophila melanogaster
Sequence 2:NP_417163.1 Gene:proV / 947148 ECOCYCID:EG10771 Length:400 Species:Escherichia coli


Alignment Length:410 Identity:94/410 - (22%)
Similarity:156/410 - (38%) Gaps:91/410 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   517 LKNISMRIYRGEVFVILGHIGSGKLTLLRILAGLKFPLRGNVYIMGNPFEPNGEA------RRLV 575
            :|:.|:.|..||:|||:|..||||.|::|:|..|..|.||.|.|.|.......:|      |:.:
E. coli    44 VKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREVRRKKI 108

  Fly   576 DFRFDEHGLNKHLTVEQTIDYHVRLKLSPSESDRYEIERRKWLAILDQHVESRGVRIG------- 633
            ...|....|..|:||.....:.:.|....:|.     .|.|.|..|.|        :|       
E. coli   109 AMVFQSFALMPHMTVLDNTAFGMELAGINAEE-----RREKALDALRQ--------VGLENYAHS 160

  Fly   634 ---KLSSGSMKLVALCCCLAGDTPIIILEEPTTQLTGREAQIFWSIVHAE----------KENRA 685
               :||.|..:.|.|...||.:..|::::|..:.|.        .::..|          |..|.
E. coli   161 YPDELSGGMRQRVGLARALAINPDILLMDEAFSALD--------PLIRTEMQDELVKLQAKHQRT 217

  Fly   686 FIIATYNVGEAEHVADRIGILSMGVLEASGTPFFLRSKFSSSVDLVIIKKPHVPDQPITDYINQF 750
            .:..::::.||..:.|||.|:..|.:...|||                  ..:.:.|..||:..|
E. coli   218 IVFISHDLDEAMRIGDRIAIMQNGEVVQVGTP------------------DEILNNPANDYVRTF 264

  Fly   751 MQNIEPENEIG---------DSLTYRLPVIYRPRLQKLLIHLEIDRKMLGI--ENVRVVGAELSD 804
            .:.::......         :.|..:.|. :.||....|:..| ||:...:  ...:.|||...|
E. coli   265 FRGVDISQVFSAKDIARRTPNGLIRKTPG-FGPRSALKLLQDE-DREYGYVIERGNKFVGAVSID 327

  Fly   805 IYMTLVTSFRLQQQMIPDVTQTFKYQVVSQKQLTKQRMRAMFYKKMIHTAPNVWPIIMIFTSFVL 869
            ...|.:|    |||.:..........|.:|..|::       ....:..||...|::.....:| 
E. coli   328 SLKTALT----QQQGLDAALIDAPLAVDAQTPLSE-------LLSHVGQAPCAVPVVDEDQQYV- 380

  Fly   870 IAIIARLSVLLDMPKERQNS 889
             .||::..:|..:.:|..|:
E. coli   381 -GIISKGMLLRALDREGVNN 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1801NP_728408.3 ABC2_membrane_3 <246..379 CDD:289468
ABC2_membrane_4 <293..448 CDD:289500
EcfA2 499..717 CDD:224047 59/225 (26%)
P-loop_NTPase 500..721 CDD:304359 61/229 (27%)
ABC2_membrane_3 <972..1254 CDD:289468
EcfA2 1307..1521 CDD:224047
P-loop_NTPase 1324..1524 CDD:304359
proVNP_417163.1 PRK10070 1..400 CDD:182221 94/410 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm14986
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
22.000

Return to query results.
Submit another query.