DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1801 and ybhF

DIOPT Version :9

Sequence 1:NP_728408.3 Gene:CG1801 / 33104 FlyBaseID:FBgn0031171 Length:1655 Species:Drosophila melanogaster
Sequence 2:NP_415315.4 Gene:ybhF / 945413 ECOCYCID:G6411 Length:578 Species:Escherichia coli


Alignment Length:286 Identity:77/286 - (26%)
Similarity:129/286 - (45%) Gaps:61/286 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   490 EFGDVGSVELMRLRHVSTSHRDSERKILKNISMRIYRGEVFVILGHIGSGKLTLLRILAGLKFPL 554
            :|||          ..:|.|          ::..:.|||:|.:||..|:||.|..:::.||..|.
E. coli   338 KFGD----------FAATDH----------VNFAVKRGEIFGLLGPNGAGKSTTFKMMCGLLVPT 382

  Fly   555 RGNVYIMGNPF-EPNGEARRLVDFRFDEHGLNKHLTVEQTIDYHVRLKLSPSESDRYEIERRKWL 618
            .|...::|... |.:|:||:.:.:...:..|..:|||||.:.:.         |..|.:..|...
E. coli   383 SGQALVLGMDLKESSGKARQHLGYMAQKFSLYGNLTVEQNLRFF---------SGVYGLRGRAQN 438

  Fly   619 AILDQHVESRGVR------IGKLSSGSMKLVALCCCLAGDTPIIILEEPTT---QLTGREAQIFW 674
            ..:.:..|:.|::      ..:|..|..:.:||.|.|..:..|:.|:|||:   .||.||   ||
E. coli   439 EKISRMSEAFGLKSIASHATDELPLGFKQRLALACSLMHEPDILFLDEPTSGVDPLTRRE---FW 500

  Fly   675 SIVHAEKENRAFI-IATYNVGEAEHVADRIGILSMGVLEASGTPFFLRSKFSSSVDLVIIKKPHV 738
            ..:::..|....: :.|:.:.|||: .||||::..|.|.|||||..|:::.::.           
E. coli   501 LHINSMVEKGVTVMVTTHFMDEAEY-CDRIGLVYRGKLIASGTPDDLKAQSAND----------- 553

  Fly   739 PDQPITDYINQFMQNI-----EPENE 759
             :||.......|:|.|     |..||
E. coli   554 -EQPDPTMEQAFIQLIHDWDKEHSNE 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1801NP_728408.3 ABC2_membrane_3 <246..379 CDD:289468
ABC2_membrane_4 <293..448 CDD:289500
EcfA2 499..717 CDD:224047 63/228 (28%)
P-loop_NTPase 500..721 CDD:304359 65/231 (28%)
ABC2_membrane_3 <972..1254 CDD:289468
EcfA2 1307..1521 CDD:224047
P-loop_NTPase 1324..1524 CDD:304359
ybhFNP_415315.4 ABC2_perm_RbbA 5..>565 CDD:411426 71/271 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 1 1.050 228 1.000 Inparanoid score I138
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.