DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1801 and RLI1

DIOPT Version :9

Sequence 1:NP_728408.3 Gene:CG1801 / 33104 FlyBaseID:FBgn0031171 Length:1655 Species:Drosophila melanogaster
Sequence 2:NP_010376.3 Gene:RLI1 / 851665 SGDID:S000002498 Length:608 Species:Saccharomyces cerevisiae


Alignment Length:392 Identity:89/392 - (22%)
Similarity:146/392 - (37%) Gaps:113/392 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   438 SALIYFLILLAIQWRMPGTFLSRRIVNNRPRKQQESDTTIMYLGRAPSFQNFEFGDVGSVELMRL 502
            |.|.|....:.|.:.:|..:    .|...|...:|. ..|...|..|: :|..|    ..|.::.
Yeast   282 SVLDYLSDFVCIIYGVPSVY----GVVTLPASVREG-INIFLDGHIPA-ENLRF----RTEALQF 336

  Fly   503 RHVSTS---HRDSERKILKNISMRIYRG--------------EVFVILGHIGSGKLTLLRILAGL 550
            |....:   ..||..:.....|::..:|              |:.|::|..|:||.||:::|||.
Yeast   337 RIADATEDLQNDSASRAFSYPSLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGA 401

  Fly   551 KFPLRG------NVYIMGNPFEPN--GEARRLVDFRFDEHGLNKHLTVEQTIDYHVRLKLSPSES 607
            ..|..|      ||.:......|.  |..|:|...:.....||.....:         .:.|...
Yeast   402 LKPDEGQDIPKLNVSMKPQKIAPKFPGTVRQLFFKKIRGQFLNPQFQTD---------VVKPLRI 457

  Fly   608 DRYEIERRKWLAILDQHVESRGVRIGKLSSGSMKLVALCCCLAGDTPIIILEEPTTQLTGREAQI 672
            |          .|:||.|:       .||.|.::.||:...|.....|.:::||:..|.. |.:|
Yeast   458 D----------DIIDQEVQ-------HLSGGELQRVAIVLALGIPADIYLIDEPSAYLDS-EQRI 504

  Fly   673 FWS------IVHAEKE----NRAFIIATYNVGEAEHVADRIGILSMGVLEASGTPFFLRSKFSSS 727
            ..|      |:|.:|.    ...||:|||       :||:       |:...|.|          
Yeast   505 ICSKVIRRFILHNKKTAFIVEHDFIMATY-------LADK-------VIVFEGIP---------- 545

  Fly   728 VDLVIIKKPH--VPDQPITDYINQFMQNIEPENEIGDSLTYRL-PVIYRPRLQKLLIHLEIDRKM 789
                 .|..|  .|:..:|. .|:|::|:        ::|:|. |..:|||:.||...::.::|.
Yeast   546 -----SKNAHARAPESLLTG-CNRFLKNL--------NVTFRRDPNSFRPRINKLDSQMDKEQKS 596

  Fly   790 LG 791
            .|
Yeast   597 SG 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1801NP_728408.3 ABC2_membrane_3 <246..379 CDD:289468
ABC2_membrane_4 <293..448 CDD:289500 3/9 (33%)
EcfA2 499..717 CDD:224047 57/252 (23%)
P-loop_NTPase 500..721 CDD:304359 58/255 (23%)
ABC2_membrane_3 <972..1254 CDD:289468
EcfA2 1307..1521 CDD:224047
P-loop_NTPase 1324..1524 CDD:304359
RLI1NP_010376.3 Rli1 4..603 CDD:224166 89/392 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.